KEGG   Picrophilus torridus: PTO1093Help
Entry
PTO1093           CDS       T00177                                 

Definition
(GenBank) hypothetical protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAT43678
UniProt: Q6L024
Position
1102413..1103564
Genome map
AA seq 383 aa AA seqDB search
MYIRYNKDFHITLLIVSYINLGYILYIKNASFLMNFGFFVNPLAGYGGMINNKGSDNLKI
SDPEASVSIKIAMKFIKNILDEDNFYIPSLYMGEEIFKSSGRDNYKIIYESKWPSSRDDT
LNFLNKLKDFDVDYIIFVGGDGTARDIVSSNIKKPVIAIPAGVKMYSSIFCINVNHAIDL
YMDVHKNVESMDSGVYDIDEDAYRSGLLKIKYFGSLMVPVSNNIVSSSKAEYNNDDAYDI
AEYIIENMDDSYYIIGPGRTCKIIVESLGYKTNILGFDVIKNMKLIKYDVDEEFLYNISL
NGKTKLIISPIGGQGFVLGRGNKQISGRVFDLIGFKNLILISDKNKINNIKNLYIDIDTS
LEIPKYLKVITGYGIYTLKRLIK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcagatataataaggattttcatataactttattaattgtttcttatattaat
cttgggtatatattatatataaaaaatgcatcatttcttatgaatttcggcttctttgta
aatccactggcaggctacggtggcatgataaataataagggctctgacaatttaaaaata
tcagaccctgaagcctctgtatcaataaagatcgcaatgaaatttattaaaaacatcctt
gatgaggacaatttttatataccatcattgtacatgggagaggaaatatttaaatcaagt
ggcagggataattataaaattatatacgaatcaaaatggccgagctcaagggatgacaca
ttaaattttttaaataaactgaaagatttcgatgtagattacataatctttgtaggtggt
gatggaaccgccagggatattgtttcatcaaatattaaaaaacctgttatagccatacct
gcaggtgtaaagatgtacagctcaatcttctgcataaatgttaaccatgcaattgacctt
tacatggatgttcataaaaacgttgagtcaatggattctggggtatacgatatagatgag
gatgcatacaggtccggccttttaaagataaaatattttggatcattaatggtaccggtt
tcaaataacattgtttcatcatcaaaggccgagtataataacgatgatgcatacgatata
gcagagtacataattgagaacatggatgattcatattatataatagggcctggcagaaca
tgcaaaattatagttgaatcgcttggttacaaaacaaatattcttggtttcgatgtaata
aaaaacatgaaattaattaagtatgatgttgatgaggaatttttgtataatatctcattg
aacggaaaaacaaaattaataatatcgccaataggaggccagggctttgttcttggccgc
ggcaacaaacagatctctggcagggtttttgatctaattggatttaaaaatttgatttta
atctcggataagaataaaataaataatattaaaaatctgtacatagatattgatacatcg
cttgaaataccaaaatatttaaaggttataacaggttacggcatttatactttgaaacgt
ctaattaaatga

DBGET integrated database retrieval system