KEGG   Picrophilus torridus: PTO1094Help
Entry
PTO1094           CDS       T00177                                 

Definition
(GenBank) N-acetylglucosamine kinase
  KO
K00884  
N-acetylglucosamine kinase [EC:2.7.1.59]
Organism
pto  Picrophilus torridus
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PTO1094
Enzymes [BR:pto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.59  N-acetylglucosamine kinase
     PTO1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1103604..1104566
Genome map
AA seq 320 aa AA seqDB search
MLLSVDGGATKTFAVVYDDLNKKVAGIGVSGPSNVRSVSEDISKKNILKAMENALNMAGN
PEINNSFFGIAGYGDSKYHSEMLNRIVSSISQNYIIENDGNAGTFLVTLGNDGVVTAIGT
GSVGSYIINGVNHRIGGWSYLTDDCGSAYWISRKAIQLAEKSHDGLIDKTTLIDLIEEIT
GLGLRDAVAELENNFNKRFFASIAARVDELSYKDKIALNVLDLAYNEIELMLLGMSRHFN
GKFIIGSVGGVMRSKHIRERLYKRFPGIKIFFGYHVAAGGILKMLSLKNGIDEILRDKIV
SEIDQKLVLLSDAEKEFLFI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttactatcggttgatggtggtgccacaaagacatttgccgttgtctacgatgattta
aacaaaaaggttgccggtattggtgtttcaggtccaagcaatgtaaggtctgtatcagag
gatatatcaaaaaagaacattttaaaggccatggagaacgccttaaacatggccggaaat
ccggagataaacaattcattctttggtatagccggctatggcgattcaaaatatcacagc
gagatgcttaacagaatagtatcctcaataagccagaattatataatagaaaatgacggt
aacgcaggcacatttcttgttacattgggaaatgatggcgttgtaactgcgataggcacg
ggatcggttggcagttacattataaacggtgttaaccacagaataggcggctggagctac
ctgacagatgactgcggctctgcctactggatatcaagaaaggcaatacagcttgctgaa
aagagccatgatggattaatagacaaaacaaccttgatagatctaatagaggaaattaca
ggtcttggtctcagggatgccgtagccgagcttgagaacaattttaataaaaggttcttt
gcatcaattgcagcaagggtggatgagctttcatataaagataaaatagccttaaatgtt
cttgaccttgcatacaacgagattgaattaatgcttctgggaatgtctaggcatttcaat
ggcaaatttataataggctctgttggaggcgtaatgcgctcaaagcatataagggaaagg
ctttataagagatttcctggtataaagatcttttttggatatcatgtggccgccggtggc
atattaaaaatgctatcattgaaaaatggtatagatgaaatcttaagggataaaattgtc
agcgaaattgatcaaaaactcgtgcttttaagcgatgctgaaaaggagtttctattcata
taa

DBGET integrated database retrieval system