KEGG   Picrophilus torridus: PTO1098Help
Entry
PTO1098           CDS       T00177                                 

Definition
(GenBank) putative ICC-like phosphoesterases
  KO
K06953  
uncharacterized protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1106853..1107587
Genome map
AA seq 244 aa AA seqDB search
MKDIRIDDNVYISNLYCAYLADIGAAVVSDLHLGFEDEMNLHGIFLPKLQFNHITKIIDN
IISRYNPEKIIINGDFKQEFSRNLPQEWDDINRFIDKYENDVSLIYIRGNHDNYLINILK
SRNIRIYNYYEDDHYYIYHGDRDLGIKKITILGHEHPSIALRDRVGGVFKIPAFVYNEEY
KVLITPAMSFFSSGTDVTQSLLSDEHFTPVLRNVSKKFRAYGITDEFGLLDFGYIEDISK
SMEI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggacataagaatagatgataatgtttacatttcgaatttatactgtgcatacctg
gcagatataggtgccgctgtggtctctgatctgcaccttggcttcgaggatgagatgaat
cttcatggtatatttctgccaaagctgcagtttaaccatattacaaagataattgataat
ataatatcaaggtataatcctgaaaagatcattataaatggcgatttcaagcaggagttc
tcaagaaacctgccacaggaatgggatgatataaatagattcatagataaatatgaaaac
gatgtttcattaatctatataaggggaaaccatgataattatctaataaacatattaaaa
tcgaggaatataaggatttataattattacgaggacgatcattattatatataccatggt
gacagggatcttggcataaaaaagattacaattctgggtcatgagcatccatcaattgca
ctgagagaccgtgtcggtggtgtttttaagataccggcgtttgtctacaatgaggaatat
aaggttttaataacaccggcaatgagcttcttctcatcaggcacagatgtaacgcagtca
ttattaagtgatgagcacttcacgcccgttctcaggaacgtttcaaaaaaattcagggcc
tatggaataacagatgaattcggcctgcttgattttggctacatcgaggacatatcaaaa
agcatggagatataa

DBGET integrated database retrieval system