KEGG   Picrophilus torridus: PTO1099Help
Entry
PTO1099           CDS       T00177                                 

Definition
(GenBank) hypothetical glycosylase
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1107616..1108542
Genome map
AA seq 308 aa AA seqDB search
MEIKRYKIDGESLRNNRLNDDFKRDLIVIENNVNDRTPVLIGLAGFFGSSESFLNRSYTG
MDFLSVLNIISKDYSFIIALPDTMTSLRGNQYLNSMAVGNYEDFIVKDVLKHLDDLYGPR
DKYLFGKSSGGFGAINLSMKHDEFSGFIDISGDSYFYYSYLNDFPVAYNILKKTGIDDFI
DNFNKKYIHSNDELTAMNIVAMSAFYSRNDKINLPFDLSDGSLNQYWNDWLSFDPVSTVN
NYLENLRKKRIVLQTGIHDEFKMYIGMKIISRTLERNNIDHVYIEYDAGHFNTNHFYLDS
IPVILKNY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggagataaaaagatataaaatagatggagaatcattaagaaacaacagacttaatgac
gatttcaaaagagatttaatagtcatagagaacaatgtaaatgatagaacgcctgtgctt
ataggccttgccggtttctttggaagttcagagagctttttaaacagaagctatacaggc
atggattttttatccgttttaaatattatatcaaaagattatagctttatcatagccctt
ccagatacaatgacatcactgcggggaaaccagtatctaaactcaatggcagtgggcaac
tacgaggacttcatagttaaagatgttttaaaacatcttgatgatctatatggtcccagg
gataaatatctatttggaaaatcatcagggggctttggggcaataaatctatcaatgaaa
catgatgaattctctggatttatagacatctcaggcgattcatatttttattattcatat
cttaatgattttcctgttgcctataatatattaaagaaaacaggaatagatgattttatt
gataattttaataaaaaatacatccattcaaatgatgaactaacggcaatgaacatagtt
gcaatgtctgcattctattcaaggaatgataagataaacctgccattcgatttatcagat
ggctcattaaaccaatactggaatgactggctttcctttgacccggtttcaacagtaaac
aattatctggaaaatctaaggaaaaagagaatagttcttcaaacaggaatccatgatgaa
ttcaaaatgtacataggcatgaagataataagcagaacactggaaagaaataatatagac
catgtttacattgaatacgatgcagggcatttcaacacaaatcatttttatcttgattca
attcctgttatacttaaaaactattaa

DBGET integrated database retrieval system