KEGG   Picrophilus torridus: PTO1100Help
Entry
PTO1100           CDS       T00177                                 

Definition
diaminopimelate aminotransferase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pto  Picrophilus torridus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pto01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pto00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108566..1109702
Genome map
AA seq 378 aa AA seqDB search
MDESFIIETAKRLIPLKSVGPLSDGPGESRKAEEICKIIKELGYNYERYDIDGRPNIIVR
IGSMEKTLWIISHMDTVPEGDINLWHYDPYQATVSGDLIYGRGTEDNGQGIFTSLLLLKN
LKPDRLKFNLGLAFVSDEETGSNFGIKYLIKNNIFKKDDLIIVPDAGTPDGRTIEIAEKS
ILWLKINSHGRQYHASMPGEAINATKELYKFVLNLESRLKEKYNKINDVFDPPYSTFEIT
KHGKNVDNINTIPGFDSQFLDCRILPDYDVNDVLRFIDDEIAGFKSPARISYEIIQREDA
PEPTKKDSEIVNLLSDAIENPKVVGIGGGTCAAFFRENGIPAVVWSTTDVDVAHQADEFV
RISNIIKDAKTIERIIYK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacgaatcatttataattgagaccgcaaagaggttaataccattgaaatctgttggg
ccattgtctgatggtcccggtgaatcaaggaaggccgaggagatatgcaaaataataaaa
gagcttggatacaattacgaaagatacgatatcgatggcaggccaaacattatagtaagg
ataggcagcatggagaaaacactatggataatatcacatatggatacagttcctgagggg
gatataaacctatggcattatgatccataccaggcaacggtttcaggcgatcttatatac
ggccgtggcaccgaggataacggtcaggggatcttcacctcgctgctcctgcttaaaaat
ttaaagccggaccgtttaaaatttaatcttggccttgcatttgtatccgacgaggaaacg
ggcagcaacttcggcataaagtatttaattaaaaataatatatttaaaaaggacgattta
ataatagtgccagatgccggcacacctgatggaagaacgatagaaatcgcagaaaaaagc
atattatggttgaagataaattcccatggaaggcagtatcatgccagcatgccaggagag
gcaatcaacgccacaaaggagttatacaaatttgttttaaatctggaatcaaggctcaag
gaaaaatacaataaaataaacgatgtttttgatccaccatattcaacctttgagataaca
aagcatggaaagaatgttgataatataaatacaatacctggatttgattcccagtttctt
gactgcaggatattaccagattatgatgtaaacgatgtacttagattcatagatgatgaa
atagccggttttaaaagcccggcaaggataagctatgaaattatacagagggaggatgct
cccgagccaacaaagaaggacagtgaaattgttaatcttctatcagatgccatagaaaac
ccaaaagtagttggcattggcggcggtacatgcgcagcattcttcagggagaatggaata
ccggcggttgtatggtcaacaacagacgttgatgttgcacaccaggccgatgaatttgtc
aggataagcaacataataaaggatgcaaaaacaatagagaggataatctataaataa

DBGET integrated database retrieval system