KEGG   Picrophilus torridus: PTO1100Help
Entry
PTO1100           CDS       T00177                                 

Definition
diaminopimelate aminotransferase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pto  Picrophilus torridus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTO1100
  Amino acid metabolism
   00300 Lysine biosynthesis
    PTO1100
Enzymes [BR:pto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PTO1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108566..1109702
Genome map
AA seq 378 aa AA seqDB search
MDESFIIETAKRLIPLKSVGPLSDGPGESRKAEEICKIIKELGYNYERYDIDGRPNIIVR
IGSMEKTLWIISHMDTVPEGDINLWHYDPYQATVSGDLIYGRGTEDNGQGIFTSLLLLKN
LKPDRLKFNLGLAFVSDEETGSNFGIKYLIKNNIFKKDDLIIVPDAGTPDGRTIEIAEKS
ILWLKINSHGRQYHASMPGEAINATKELYKFVLNLESRLKEKYNKINDVFDPPYSTFEIT
KHGKNVDNINTIPGFDSQFLDCRILPDYDVNDVLRFIDDEIAGFKSPARISYEIIQREDA
PEPTKKDSEIVNLLSDAIENPKVVGIGGGTCAAFFRENGIPAVVWSTTDVDVAHQADEFV
RISNIIKDAKTIERIIYK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacgaatcatttataattgagaccgcaaagaggttaataccattgaaatctgttggg
ccattgtctgatggtcccggtgaatcaaggaaggccgaggagatatgcaaaataataaaa
gagcttggatacaattacgaaagatacgatatcgatggcaggccaaacattatagtaagg
ataggcagcatggagaaaacactatggataatatcacatatggatacagttcctgagggg
gatataaacctatggcattatgatccataccaggcaacggtttcaggcgatcttatatac
ggccgtggcaccgaggataacggtcaggggatcttcacctcgctgctcctgcttaaaaat
ttaaagccggaccgtttaaaatttaatcttggccttgcatttgtatccgacgaggaaacg
ggcagcaacttcggcataaagtatttaattaaaaataatatatttaaaaaggacgattta
ataatagtgccagatgccggcacacctgatggaagaacgatagaaatcgcagaaaaaagc
atattatggttgaagataaattcccatggaaggcagtatcatgccagcatgccaggagag
gcaatcaacgccacaaaggagttatacaaatttgttttaaatctggaatcaaggctcaag
gaaaaatacaataaaataaacgatgtttttgatccaccatattcaacctttgagataaca
aagcatggaaagaatgttgataatataaatacaatacctggatttgattcccagtttctt
gactgcaggatattaccagattatgatgtaaacgatgtacttagattcatagatgatgaa
atagccggttttaaaagcccggcaaggataagctatgaaattatacagagggaggatgct
cccgagccaacaaagaaggacagtgaaattgttaatcttctatcagatgccatagaaaac
ccaaaagtagttggcattggcggcggtacatgcgcagcattcttcagggagaatggaata
ccggcggttgtatggtcaacaacagacgttgatgttgcacaccaggccgatgaatttgtc
aggataagcaacataataaaggatgcaaaaacaatagagaggataatctataaataa

DBGET integrated database retrieval system