KEGG   Picrophilus torridus: PTO1101Help
Entry
PTO1101           CDS       T00177                                 

Definition
(GenBank) putative thymidylate kinase
  KO
K00943  
dTMP kinase [EC:2.7.4.9]
Organism
pto  Picrophilus torridus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PTO1101
Enzymes [BR:pto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     PTO1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1109693..1110301)
Genome map
AA seq 202 aa AA seqDB search
MIDNGSMFIAIEGIDGSGKTTLAGDIASYTGFYLTREPTDRFCYDYIEADYNDESSIINF
FLFTLDRYMHQKEIKNHLINGVISDRYVFSSIAYQGSGMEKRFKNMDETISWMLDVSRFI
IMPDLIIYLKIDPGIALKRLNLRKNEKKNTDAFERLEMLKNVSKYYDYIFSGIIKIPVIK
INAEMEYNYVKDEAIKGLNDYL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcgataatggttcaatgttcatagccatagagggcatcgatggatcgggtaagacc
acgcttgcgggcgatattgccagttatacaggcttttatctgacaagggagccaacagac
agattctgctatgattacatagaggccgattacaatgatgaaagcagcataataaatttt
ttcctctttacacttgacaggtacatgcaccagaaggagataaaaaaccatctaataaat
ggtgtaatctcagatagatatgtattttcttccattgcataccagggatccggcatggaa
aaaaggtttaaaaatatggatgaaacaatatcatggatgcttgacgtctcaagatttata
ataatgccggatctaataatttatttaaagatagatcccgggattgcgttaaagagattg
aatctcaggaagaatgagaaaaaaaacactgatgcctttgagaggctggagatgcttaaa
aacgtttcaaaatactatgattacatattttcagggattataaagatacctgttataaaa
atcaatgcggaaatggaatataattatgtaaaagatgaggcgataaaaggattaaatgat
tatttatag

DBGET integrated database retrieval system