KEGG   Picrophilus torridus: PTO1166Help
Entry
PTO1166           CDS       T00177                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pto  Picrophilus torridus
Pathway
pto00010  Glycolysis / Gluconeogenesis
pto00030  Pentose phosphate pathway
pto00051  Fructose and mannose metabolism
pto00052  Galactose metabolism
pto00230  Purine metabolism
pto00500  Starch and sucrose metabolism
pto00520  Amino sugar and nucleotide sugar metabolism
pto00521  Streptomycin biosynthesis
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
pto01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTO1166
   00030 Pentose phosphate pathway
    PTO1166
   00051 Fructose and mannose metabolism
    PTO1166
   00052 Galactose metabolism
    PTO1166
   00500 Starch and sucrose metabolism
    PTO1166
   00520 Amino sugar and nucleotide sugar metabolism
    PTO1166
  Nucleotide metabolism
   00230 Purine metabolism
    PTO1166
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PTO1166
Enzymes [BR:pto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PTO1166
    5.4.2.8  phosphomannomutase
     PTO1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AAT43751
UniProt: Q6KZV1
Position
1166148..1167479
Genome map
AA seq 443 aa AA seqDB search
MKYFGTNGIRGIPNEDLTTELSMTVGKAVSTYFNSKTIAVAKDTRISGDMIMNAVISGVM
STGTDVKYLGILPTPGLQYYCKKHNLPGIMITASHNPPEYNGIKCIASDGTEISEESEKE
IEDLIDSKKFKKVSWESSGRLYPESNAIDEYINGIMSLVDVDKIRDRKFKVVIDTGNGAA
YFTSPYLLSKYNCHIVSLNANPDGTFSSRNSEPKPENLGDLISLMRSGNFDIGIAHDGDA
DRCVFIDEHGNFIDGDKSLALIVKYTVKNGDTVVTPVSSSDALSDICAEKNAKLIKTRVG
APIVARTMIENRAVIGGEENGGIIYGKHQYCRDGAMTLSLMLNLLASEKKTLSQLLNDIP
DYTIVKSSVERRRGWEEIRKDLIERIDKKIDETDGLKILEDEGWVLIRPSGTEKIIRIYA
ESKSRDKAAELSNKYRSLLNELL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattttggtacaaacggcatccgtggcattccaaacgaggatctcacaacagaa
ctatcaatgaccgttggcaaggccgtctcaacgtattttaattcaaaaaccattgctgtt
gccaaggatacaaggatcagcggcgatatgataatgaacgctgttatctctggtgtgatg
tcgaccggaaccgatgttaaataccttgggattcttccaacgcccgggcttcagtattac
tgcaagaaacataatttgccaggaataatgataactgcaagccacaatccaccggagtac
aatggcataaaatgcattgccagtgatggaactgaaatatcagaggaatcagaaaaggaa
atagaggatctcattgatagcaaaaaatttaaaaaggtttcatgggaatcatctggaagg
ctttatccagagagcaatgccatagatgaatacataaacggaataatgtctcttgttgat
gttgataagatacgcgatagaaaatttaaggttgttatagataccggaaacggtgcagca
tattttacaagcccgtaccttctatcaaagtacaactgtcacatagtatcattgaatgca
aatcctgacggtacattctcatcaagaaattccgagccaaaaccggaaaatcttggtgac
ctaatatcattaatgagatccggcaactttgatataggcatagcacatgatggcgatgcc
gaccgctgtgtctttatagacgagcacggaaactttattgatggtgataagagccttgcg
cttatagtaaagtacacagtaaaaaatggagatacggttgtaacacctgtaagcagctcc
gatgcactttccgatatatgtgctgaaaagaatgcaaaacttataaaaacgagggttggg
gcaccgatagttgcaagaaccatgatagaaaacagggcagtaataggcggtgaggaaaat
ggcggtataatatacggcaaacatcagtactgcagggatggtgcaatgaccctatcgtta
atgttgaacctgcttgcatcagagaagaaaacgctttcacagcttttaaatgatataccg
gactacacgatagtaaaaagctctgtggaaagaaggcgtggctgggaggaaataagaaag
gatctaattgaaagaatagataaaaagatcgatgaaaccgatggcttaaagatccttgaa
gatgaaggctgggttcttataaggccctcaggaaccgagaaaattataagaatatacgca
gaatctaaaagcagggataaggcagcagagctttcaaataaatacagatcattgttaaac
gaattactttaa

DBGET integrated database retrieval system