KEGG   Picrophilus torridus: PTO1216Help
Entry
PTO1216           CDS       T00177                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pto  Picrophilus torridus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTO1216
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTO1216
   00052 Galactose metabolism
    PTO1216
   00500 Starch and sucrose metabolism
    PTO1216
   00520 Amino sugar and nucleotide sugar metabolism
    PTO1216
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PTO1216
   00524 Butirosin and neomycin biosynthesis
    PTO1216
Enzymes [BR:pto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PTO1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1216199..1217152
Genome map
AA seq 317 aa AA seqDB search
MHYKPMGFILGYDVGGTKISAVIGDETGKIHDTLRKRTLKEYGKEGLSAELIAMGEELLR
KNHINSIDKVGIIFAGPVDSKNGIIVASPNIIGLKNFNIKKPLEDHFNVPVYLDNDAAAA
AISERIFGSGKNVDNFIYITLSTGIGAGIFINGKLYKGSHGMAGEVGHMAIMPNGSVCGC
GRRGCWETIASGKGIARRTMENITALRDSTELSKLRSSEIDAKAVFRAMDKGDMFAQLMV
EETIYYIAFGIVNLINILDPELIIIGGGLSFEGEKLFKPLRMAIKEEIKSLKRKVRIVKA
LENGADIGSIAITMYYD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcattataagccgatgggctttatacttggttatgatgttggcggaaccaagatttcc
gctgttattggtgatgaaacagggaagattcacgatacattaaggaaaagaacattgaag
gaatacggcaaggagggtctttcggccgagttaattgccatgggcgaggagcttctaaga
aaaaatcatataaattcaatagacaaggttggaataatctttgctggtcctgttgattca
aagaacggtataatagttgcatcaccgaacattataggcttaaaaaatttcaatataaaa
aaaccattggaggatcatttcaatgttccggtatatcttgataatgatgcggctgcagcg
gcaatttcagaaagaatcttcggatcaggcaaaaatgttgataattttatatatataaca
ttgagcactggcataggcgccgggatatttataaatggaaaactatacaagggatctcac
ggcatggccggtgaggttggccacatggcaataatgccaaacggttcggtatgcggttgt
ggaaggcgcggctgctgggaaaccattgcatcaggcaagggtattgcaagacgcacgatg
gaaaatataacggctctcagggactcaacagagctctcaaagcttaggtcatcagagatt
gatgcaaaggctgttttcagggcaatggataaaggggacatgttcgcacagctaatggtt
gaggagacgatatattatatagcgtttggcatagttaatctaataaacatacttgacccg
gagcttattataatcggcggcggcctgtcattcgagggtgagaagctctttaaaccgttg
agaatggcaataaaggaggagataaaaagccttaagaggaaagtcaggattgtaaaggca
ctggaaaatggtgcagatattggctcaatagcaataacaatgtattatgattaa

DBGET integrated database retrieval system