KEGG   Picrophilus torridus: PTO1237Help
Entry
PTO1237           CDS       T00177                                 

Definition
(GenBank) 6-phosphofructokinase
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1237611..1238507)
Genome map
AA seq 298 aa AA seqDB search
MKFLAFFGHINIDVKISVPRLPMREESVGVKNVSNEFAGTAGNFAFVAAALGLSFDLYSK
VGSLTHNDYINELRRRKINIDHVEIENSMGPICYIPTDGNEQVAYMYQGPMDSWRPSLSF
DYNYKYVHLGTGPSDEYQKIAANNEKSRIVFDPGQEIWYLYNKDKIIDIMSRSYISMFNK
NEFNYLKSMTGLSEHELNNLSDYIIVTMGSDGASVFHKNNEFHVPAVKSDFIYDTIGAGD
SFRAGFYFGIYNNYSINDSVLIGNIVASIAIRRRIIEFNENRNNIIKMFNNMKLKQRV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctggccttttttgggcacataaacattgatgttaaaatatctgttcccagg
ctgcctatgcgggaggaatcagttggtgttaaaaatgtttctaatgagtttgcaggcact
gcaggcaattttgcctttgtagcggcagcccttggtttgagctttgatttgtattcaaag
gtcggttcattaacgcataatgactacataaatgagctcaggagaagaaaaataaacata
gaccatgttgaaatagagaattcaatgggaccgatatgctatataccaacagatggaaat
gaacaggttgcatatatgtaccagggcccaatggattcatggaggccatcattatccttt
gattataattataaatatgtccaccttggcaccggcccatcagatgagtaccaaaaaata
gctgcaaacaatgaaaaatcaaggatagtctttgatcctggccaggagatatggtacctt
tacaataaggataaaataatagatataatgtcaaggtcttacatatcaatgtttaataag
aatgagtttaattacctaaaatcaatgactggtctttccgagcatgagttaaataatctt
agcgattatataatagtaacgatgggttctgatggtgcatccgttttccataaaaataat
gagtttcatgttcccgctgttaaatcagattttatatatgatacaataggtgccggtgat
tcattcagggcaggcttctattttggtatctataacaattacagcataaatgattctgtt
ctaattggaaacattgtcgcatcaattgcaataagaagaagaataattgaattcaatgaa
aacaggaataatataataaaaatgtttaataatatgaaactaaagcagcgagtctaa

DBGET integrated database retrieval system