KEGG   Picrophilus torridus: PTO1237Help
Entry
PTO1237           CDS       T00177                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pto  Picrophilus torridus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTO1237
   01230 Biosynthesis of amino acids
    PTO1237
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTO1237
   00030 Pentose phosphate pathway
    PTO1237
   00051 Fructose and mannose metabolism
    PTO1237
   00052 Galactose metabolism
    PTO1237
  Energy metabolism
   00680 Methane metabolism
    PTO1237
Enzymes [BR:pto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PTO1237
Protein phosphatases and associated proteins [BR:pto01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PTO1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1237611..1238507)
Genome map
AA seq 298 aa AA seqDB search
MKFLAFFGHINIDVKISVPRLPMREESVGVKNVSNEFAGTAGNFAFVAAALGLSFDLYSK
VGSLTHNDYINELRRRKINIDHVEIENSMGPICYIPTDGNEQVAYMYQGPMDSWRPSLSF
DYNYKYVHLGTGPSDEYQKIAANNEKSRIVFDPGQEIWYLYNKDKIIDIMSRSYISMFNK
NEFNYLKSMTGLSEHELNNLSDYIIVTMGSDGASVFHKNNEFHVPAVKSDFIYDTIGAGD
SFRAGFYFGIYNNYSINDSVLIGNIVASIAIRRRIIEFNENRNNIIKMFNNMKLKQRV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctggccttttttgggcacataaacattgatgttaaaatatctgttcccagg
ctgcctatgcgggaggaatcagttggtgttaaaaatgtttctaatgagtttgcaggcact
gcaggcaattttgcctttgtagcggcagcccttggtttgagctttgatttgtattcaaag
gtcggttcattaacgcataatgactacataaatgagctcaggagaagaaaaataaacata
gaccatgttgaaatagagaattcaatgggaccgatatgctatataccaacagatggaaat
gaacaggttgcatatatgtaccagggcccaatggattcatggaggccatcattatccttt
gattataattataaatatgtccaccttggcaccggcccatcagatgagtaccaaaaaata
gctgcaaacaatgaaaaatcaaggatagtctttgatcctggccaggagatatggtacctt
tacaataaggataaaataatagatataatgtcaaggtcttacatatcaatgtttaataag
aatgagtttaattacctaaaatcaatgactggtctttccgagcatgagttaaataatctt
agcgattatataatagtaacgatgggttctgatggtgcatccgttttccataaaaataat
gagtttcatgttcccgctgttaaatcagattttatatatgatacaataggtgccggtgat
tcattcagggcaggcttctattttggtatctataacaattacagcataaatgattctgtt
ctaattggaaacattgtcgcatcaattgcaataagaagaagaataattgaattcaatgaa
aacaggaataatataataaaaatgtttaataatatgaaactaaagcagcgagtctaa

DBGET integrated database retrieval system