KEGG   Picrophilus torridus: PTO1346Help
Entry
PTO1346           CDS       T00177                                 

Definition
radical SAM superfamily protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pto  Picrophilus torridus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347856..1349451
Genome map
AA seq 531 aa AA seqDB search
MQGSLKIFIISYNDYIMDFFDDITLELDSGEIKNKEDLQREKIRLSKIYNLDYIPSDVEI
LNYKNNKKYENILKIKPTRTISGVAVVAAMTSPERCPHGKCIFCPGGVDTNSPQSYTGFE
PSALRGRYNSYDSYNITFNRLKQLETIGHDTSKVDLIIMGGTFTARSPDYQRAFVKGCLD
GMNKYVSGSLEESMLMNESSQRRCIGLTVETKPDWFMEGDIDLALEYGTTKVELGVQILN
DRILNINNRGHGLAEIIRSTRLARDAGLKIVYHIMPGMYGSSYSDDVKSFDEMFSNSDYM
PDMLKIYPTLVVRGTSLYKLWKSGKYVPYDTERAVNLITYFMARMPPWVRVMRMQRDIPV
QFIEAGVKRSDLRNLVMENLKKLNLKTMEIRSREIGIEKHKYNNDFRLVRRNYRAGSGDE
IFLSYENSNDDIIGFIRLRIPSEYAHRKEVYNSSIIREIKVFGNIVPLGSHNSNEWQHHG
LGHNLLNEAERITRDEYGLKRILVISGIGVRNYFRKYGYERLGPYMAKSLY
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcagggatcacttaaaatttttataataagttacaatgattatataatggatttcttt
gatgatataacgctggagcttgattcaggcgaaataaaaaataaggaggatcttcaaagg
gagaagattcgtttatcaaagatttataatctagattacataccaagcgacgtcgagata
ttaaattataaaaataataaaaagtatgaaaatatattaaagataaagccaacaaggaca
atatccggtgttgcagttgtggcggccatgacatcgccggagcgctgtccccatggaaaa
tgcatattctgccctggaggcgttgacacaaattcaccgcagtcatatactggattcgaa
ccatccgcactgaggggcaggtacaattcatatgattcatacaatataacatttaataga
ttaaaacagcttgaaacaataggccatgatacaagcaaggttgatttaataataatgggt
ggaacatttacggcgagatcaccagattatcaaagggcatttgttaagggctgtcttgac
ggtatgaataaatatgtgtctggcagcctcgaggaatcaatgcttatgaatgagagctca
cagagacgctgtataggactaaccgttgaaacaaagccggactggtttatggaaggggat
atagacctggcacttgaatatggaacaacaaaggttgagcttggtgttcagatattaaat
gacaggatacttaatataaataacaggggtcatggccttgccgagataataagatcaacc
agactggccagggacgcaggtttaaagattgtttaccatatcatgccagggatgtacggt
tcctcatattccgatgatgtaaaaagctttgatgagatgttttcaaacagtgattacatg
ccggatatgttaaagatctatccaacactggttgtaaggggcacatcgctttataaactc
tggaaatcaggaaaatatgtgccatacgataccgagagggctgttaatttaataacctac
ttcatggcaaggatgccgccatgggtaagggttatgagaatgcagcgtgatataccagtc
cagttcatagaggccggtgtaaaacgcagtgatttaagaaaccttgtcatggaaaatttg
aaaaaactcaatttaaagacaatggagataagatcaagggagataggcattgaaaaacat
aaatataacaatgatttcaggcttgtaagaaggaattacagggcaggcagcggggatgaa
atatttttatcctatgaaaacagcaatgatgatataataggctttataaggttaagaata
ccatcagagtatgcccatagaaaggaggtttataattcatcgataatacgtgagataaag
gtttttggcaacatcgttccacttggctctcataacagcaacgaatggcagcatcacggc
cttgggcataacctgcttaatgaggcggagcgcataacaagggatgaatacggtttaaaa
agaatacttgtaataagtggaatcggtgtaaggaattactttagaaaatatggttatgaa
agacttgggccatacatggcaaaaagcctgtattaa

DBGET integrated database retrieval system