KEGG   Picrophilus torridus: PTO1347Help
Entry
PTO1347           CDS       T00177                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pto  Picrophilus torridus
Pathway
pto00051  Fructose and mannose metabolism
pto01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PTO1347
Enzymes [BR:pto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PTO1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AAT43932
UniProt: Q6KZC0
Position
complement(1349448..1350098)
Genome map
AA seq 216 aa AA seqDB search
MYDHEKERIIEASRDIISSSLTVGSWGNISMRAHDGNIVITPSGKNYKKLSKEDLIVTDI
NGNIISGKYKPSSERLMHYEIYKKRKDVNAIVHTHAVYSSVLSVIDEDLPVITEDVAMLL
GHVRVAKYAITGSMDLALNVASVLNDANAAIMANHGAVAVGVDMERAYTAAQVLEKSCKI
FVLSRIIGRVNVVPEEDAKQLSKISESYLSQWKNWD
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaccatgaaaaagagagaataatagaggcctcaagagatattatatcatcatcg
cttaccgttggttcatggggaaatataagcatgagagcccatgatggcaacattgttata
acaccaagcgggaaaaattataaaaagttatcaaaggaggatcttattgtaacagatata
aatggaaatattatatcaggaaaatataaaccttccagtgaaagactaatgcattatgaa
atatacaaaaaaaggaaggatgtaaatgcaattgtccacacacatgctgtttattcatcg
gtactttcagtaattgatgaggatctgcctgttataaccgaggatgttgccatgctgctt
ggccatgttcgtgttgcaaaatatgcaataacgggaagcatggatcttgcattaaacgtt
gcatccgttcttaatgatgcaaatgcggcaataatggcaaaccatggggcagttgccgta
ggcgtcgatatggaacgcgcatatacagctgcacaggttcttgaaaagtcatgcaagatc
tttgttctatcaaggataatcggcagggtaaacgtcgttcctgaagaggatgcaaaacag
ctttcaaagatatctgaatcgtatctatcccaatggaagaactgggattaa

DBGET integrated database retrieval system