KEGG   Picrophilus torridus: PTO1399Help
Entry
PTO1399           CDS       T00177                                 

Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
pto  Picrophilus torridus
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pto00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pto00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pto00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1398572..1399603)
Genome map
AA seq 343 aa AA seqDB search
MRLNDPVHYDGAWHVYKYSDVKHVLMNDKIFSSNPGNRYSNAGGISFITMDNPEHKEFRD
ISAPYFLPSKINDYKDFIEETSNDLIKNIDNKDIISEYAVRLPVNIISKILGIPDSDMPL
FKLWSDYIIGNKRDENFNYVNNRMVSRLLEIFKSDSHGIINVLAGSSLKNRKLTMDEKIK
YIMLLIIGGNETTTNLIGNMIRVIDENPDIIDDALKNRSGFVEETLRYYSPIQFLPHRFA
AEDSYINNKKIKKGDQVIVYLGSANRDETFFDEPDLFKIGRREMHLAFGIGIHMCLGAPL
ARLEASIALNDILNHFKRIKIDYKKSRLLDNKMVLGYDKLFLS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagattaaatgacccggtgcactatgatggcgcatggcatgtttataaatacagtgat
gtaaaacatgttttgatgaacgataaaatattttcctcaaatccaggtaataggtattca
aatgccggtggtataagctttataacaatggataaccctgagcataaagaattcagggat
atatcagcaccgtactttttgccgtcaaagatcaatgattataaagattttatagaggaa
acctcaaatgatttaataaaaaatatagataacaaagatattatttcagagtatgctgtg
aggcttccggtaaatattatatcaaaaatacttggaatacctgattctgacatgccattg
tttaagctatggtctgattatataataggaaataaaagggatgagaacttcaattatgtt
aacaataggatggtttcaaggcttttagagatctttaaatctgattcacatggtataata
aatgtgctggcaggatcgtcattaaaaaatagaaaactaaccatggatgaaaagataaaa
tacataatgcttttaataataggcggaaacgagacaacaacaaaccttataggaaacatg
ataagggtaattgatgaaaaccctgatattattgacgatgcattaaaaaacagatcaggc
tttgttgaggaaactctaaggtattattcaccaatacagtttctaccgcataggtttgca
gcagaggattcttacataaacaataaaaaaataaaaaagggtgatcaggtaattgtttac
cttggctcggcaaacagggatgaaacattctttgatgagcccgatttatttaaaattggc
agaagggagatgcaccttgcctttggcataggaattcacatgtgtctcggggcaccgctt
gcaaggcttgaggcatcaatagcattaaatgatatattgaatcattttaaaaggataaaa
atagattataaaaaatccaggcttcttgataataaaatggttcttggctatgataagcta
tttctttcctga

DBGET integrated database retrieval system