KEGG   Picrophilus torridus: PTO1453Help
Entry
PTO1453           CDS       T00177                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pto  Picrophilus torridus
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pto00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pto00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1450723..1452210)
Genome map
AA seq 495 aa AA seqDB search
MLPKNFLLGFSLAGFQSEMGISDPDSNSDWWLWVHDPVNIRTGLVSGDLPENGIGYWDLY
KKYNGLAVQTGMNAARLGVEWSRIFPKSTEEVKVMEDYKDDDLISVDVNEGSLEKLDRLA
NQKAINRYMEIFNNIKENNMTLIVNVYHWPIPIYLHDPIEARNSGLSNKRNGWLNHKTVV
EFVKYAKYLAWKFSDVADMFSIMNEPNVVFGNGYFNVKSGFPPAFPSVHGGLLAKKHEIE
AIARSYDAMKEITKKPVGLIMANSDVQPLTDEDKEAAEMATYNDRYSFIDPLRVGEMKWA
DEVTAGNPIGEKSNIDRSDLKNKLDWIGVNYYTRAVVKKSGNGYTTLKGYGHSATAGMPS
RAGRDVSDFGWEFYPEGLVNVLSSYWKRYHIPMIVTENGVADSIDRLRPRYLVSHIKSVE
KALSMGMDIRGYLHWSLIDNYEWASGFSMKFGLYGIDLNNKKIQHRPSALVFKEIANANG
VPEEFEWMADQHQNS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgttacccaagaactttttacttggcttttctctggctggctttcagtctgaaatgggc
atatcagatcctgatagcaattcagattggtggttatgggtacatgacccggtgaatata
aggactggacttgtatctggtgacttacctgaaaatggaataggatactgggatctttac
aaaaaatataatggtctggctgttcaaacaggaatgaatgctgcaaggcttggagttgaa
tggagcaggatatttccaaaaagtactgaagaagtaaaggtgatggaagattacaaagat
gatgatttaatttccgtggatgttaatgagggaagtcttgaaaaacttgacagactggca
aatcaaaaggcaattaatagatatatggaaatcttcaataatatcaaggaaaataatatg
acgctaatagtgaatgtttaccattggccaataccaatatatcttcacgatccaatagaa
gctaggaatagtggactttcaaataaaagaaatggctggcttaatcataaaaccgttgtg
gaatttgtaaaatatgcaaaatatctggcatggaaatttagcgatgtggcagatatgttt
tctataatgaatgagccaaacgttgtatttggtaatggatattttaatgttaaatcaggg
ttcccaccagcatttccaagtgtgcatggcggtttgcttgcaaaaaaacatgaaattgag
gctatagcaagatcatacgacgccatgaaggagattacaaaaaaaccagttggtctaatt
atggcaaattcagatgtacaaccactaacagatgaggataaagaagcagcagaaatggct
acttacaatgatcgctattcattcatagatccgctaagagttggtgagatgaaatgggct
gatgaggttactgcaggtaatccaattggtgaaaagagcaacatcgatagatctgatcta
aaaaataagctagactggataggtgttaactattatacaagggccgttgtaaaaaaatct
ggaaacggatatacaacattaaaaggatatggacactctgcaaccgctggcatgccaagt
agggccggaagggatgtaagtgactttggctgggaattctatccagaaggtcttgtaaac
gtcttatcatcatactggaaaagatatcacattccaatgattgtgactgaaaatggtgtt
gctgactctattgatagacttagaccaaggtaccttgtgtcacatataaagtctgttgaa
aaggctttatctatgggtatggatattaggggatatcttcactggtctctgattgataac
tatgaatgggcatcaggtttttcaatgaaatttgggctttatggtattgatttgaacaat
aaaaagattcaacacagaccaagtgcactggtatttaaagaaattgcaaatgccaacgga
gtcccggaggaatttgaatggatggcagaccagcatcagaattcatga

DBGET integrated database retrieval system