KEGG   Picrophilus torridus: PTO1484Help
Entry
PTO1484           CDS       T00177                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pto  Picrophilus torridus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pto00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484929..1486278
Genome map
AA seq 449 aa AA seqDB search
MIGAVDEGTGSTRFTVYDNEMNTLYSSKRRIRTFHNNRTAEQDPNEIYNKTMINIKDAIK
RFHIRAIGVTNQRETSIFWNNEGMPLANAISWQDKRFSSYAKMLKKEYGDLFIKKTGLIP
DPYFSAIKIKYLMSRNPLLREKAANGRIKFGTVDSYILYKMLNRHVTDYSNASRTMLFNI
KNLEYDDEILKILDIPEKMLPEPMPSDSFFGSWHGIDINAVLGDQNSSLFGHNLIKDDPV
KATFGTGTFIMSLTSDLNVSSRLLKTIAWSMENNIKYALEGSIFDSGSFYNWARSTFSGD
PVYQNRIVMVPAFSGLGAPYWEPGARTVITGIDYNSTGSELLSAAIQGIGFQVYDILKEI
KNRKYMTCDGSGSRNEFLMQFISDLSNIDVITLNEHEITSFGIAAMAGTSSGIIKDINKP
GIERIYTPSGRDYRYLYKKWRHAVNLSIS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgataggtgcagttgatgagggtacaggctccacaagattcaccgtctatgataatgaa
atgaacacattatattcaagcaaaaggagaataagaacatttcataacaatagaacggca
gaacaggacccaaatgaaatttataacaaaacaatgataaatatcaaagatgccattaaa
agatttcatatcagggcaattggcgtaacaaatcaaagggagacatcaatattctggaac
aatgagggcatgccactggcaaatgcaatatcatggcaggataagagattttcctcatac
gcaaaaatgttaaaaaaggaatacggcgatctttttattaaaaaaacgggcttaatacca
gatccatacttcagcgcgataaagataaaatacctaatgtcaagaaatccattgttaagg
gagaaggcagccaatggcaggataaaattcggaacggttgattcttatatattatacaag
atgctgaacaggcatgttacagattactcaaatgcatcaagaacaatgcttttcaacata
aaaaatctggaatacgatgatgaaatcctaaaaattcttgatataccagaaaagatgctt
ccagagcccatgccatcagattcattctttggttcatggcatggtattgatataaacgct
gttttaggcgatcaaaattcatcacttttcggtcataatttaataaaggacgatccggta
aaggccacttttggaaccggaacatttataatgtcattgacttcagatttaaatgtaagc
agcaggcttttaaaaacaatagcatggtccatggaaaataatataaagtatgcacttgag
ggctcaatatttgattcaggatcattttacaactgggcaaggagtacattttcaggagat
cctgtttatcagaacaggatagttatggttcctgcattttctggccttggtgctccatac
tgggaacctggtgcaagaacagtaataacaggcattgactataactcaaccggttctgag
ctgctttctgcagcaatccagggcatcggctttcaggtctatgatatactaaaggagata
aaaaacaggaagtacatgacatgcgacggctctggctcaagaaatgagtttttaatgcag
ttcatatcagatctatcaaacatcgatgtaataacattaaatgaacatgagataacatca
tttggcatagctgcaatggccggcacatcctctggaattataaaggatataaataaacca
ggcatagaaagaatttatacgccatcaggaagggattacagatatttatataaaaaatgg
aggcatgccgttaatttatcaatatcatag

DBGET integrated database retrieval system