KEGG   Picrophilus torridus: PTO1484Help
Entry
PTO1484           CDS       T00177                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pto  Picrophilus torridus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PTO1484
Enzymes [BR:pto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PTO1484
Exosome [BR:pto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTO1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484929..1486278
Genome map
AA seq 449 aa AA seqDB search
MIGAVDEGTGSTRFTVYDNEMNTLYSSKRRIRTFHNNRTAEQDPNEIYNKTMINIKDAIK
RFHIRAIGVTNQRETSIFWNNEGMPLANAISWQDKRFSSYAKMLKKEYGDLFIKKTGLIP
DPYFSAIKIKYLMSRNPLLREKAANGRIKFGTVDSYILYKMLNRHVTDYSNASRTMLFNI
KNLEYDDEILKILDIPEKMLPEPMPSDSFFGSWHGIDINAVLGDQNSSLFGHNLIKDDPV
KATFGTGTFIMSLTSDLNVSSRLLKTIAWSMENNIKYALEGSIFDSGSFYNWARSTFSGD
PVYQNRIVMVPAFSGLGAPYWEPGARTVITGIDYNSTGSELLSAAIQGIGFQVYDILKEI
KNRKYMTCDGSGSRNEFLMQFISDLSNIDVITLNEHEITSFGIAAMAGTSSGIIKDINKP
GIERIYTPSGRDYRYLYKKWRHAVNLSIS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgataggtgcagttgatgagggtacaggctccacaagattcaccgtctatgataatgaa
atgaacacattatattcaagcaaaaggagaataagaacatttcataacaatagaacggca
gaacaggacccaaatgaaatttataacaaaacaatgataaatatcaaagatgccattaaa
agatttcatatcagggcaattggcgtaacaaatcaaagggagacatcaatattctggaac
aatgagggcatgccactggcaaatgcaatatcatggcaggataagagattttcctcatac
gcaaaaatgttaaaaaaggaatacggcgatctttttattaaaaaaacgggcttaatacca
gatccatacttcagcgcgataaagataaaatacctaatgtcaagaaatccattgttaagg
gagaaggcagccaatggcaggataaaattcggaacggttgattcttatatattatacaag
atgctgaacaggcatgttacagattactcaaatgcatcaagaacaatgcttttcaacata
aaaaatctggaatacgatgatgaaatcctaaaaattcttgatataccagaaaagatgctt
ccagagcccatgccatcagattcattctttggttcatggcatggtattgatataaacgct
gttttaggcgatcaaaattcatcacttttcggtcataatttaataaaggacgatccggta
aaggccacttttggaaccggaacatttataatgtcattgacttcagatttaaatgtaagc
agcaggcttttaaaaacaatagcatggtccatggaaaataatataaagtatgcacttgag
ggctcaatatttgattcaggatcattttacaactgggcaaggagtacattttcaggagat
cctgtttatcagaacaggatagttatggttcctgcattttctggccttggtgctccatac
tgggaacctggtgcaagaacagtaataacaggcattgactataactcaaccggttctgag
ctgctttctgcagcaatccagggcatcggctttcaggtctatgatatactaaaggagata
aaaaacaggaagtacatgacatgcgacggctctggctcaagaaatgagtttttaatgcag
ttcatatcagatctatcaaacatcgatgtaataacattaaatgaacatgagataacatca
tttggcatagctgcaatggccggcacatcctctggaattataaaggatataaataaacca
ggcatagaaagaatttatacgccatcaggaagggattacagatatttatataaaaaatgg
aggcatgccgttaatttatcaatatcatag

DBGET integrated database retrieval system