KEGG   Psychroflexus torquis: P700755_000039Help
Entry
P700755_000039    CDS       T02275                                 

Definition
outer membrane phospholipase A1, putative
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ptq  Psychroflexus torquis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ptq00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ptq00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ptq00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ptq00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ptq00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
40857..41744
Genome map
AA seq 295 aa AA seqDB search
MKTKILILFIFAFQISHSQSIFGEDKVITKSMSERWELDDEDKNGTFKLTYYNPVYVLPT
RWSNNPNELPQSENPENSFEDPENYNQIEAKFQLSLKTKLIQSFLFGHGDIWLGYTQLAN
WQVYNDPISRPFRELNYEPELIVNFPLNITLFGLDLRMAGFAFNHQSNGRDLPRSRSWNR
LVFHAAFERDNFQMYLRPWIRIESSDKDDNPSIENYIGRLEATFIYNINKHSLLVIGKNA
MDFDENRGSLEVNYLYSVKSNLRLHLQVFTGYGETLIDYNHKQTTIGLGVSFIDW
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaaattctcatattatttatttttgcatttcaaattagccattctcaatcc
atatttggagaggataaagtcattacaaaaagcatgtcagagcgctgggaattagatgat
gaagataaaaatgggacctttaaattaacttattacaatcctgtgtatgttttacccaca
cgatggtccaacaacccgaacgaactaccacaaagtgaaaacccagagaatagctttgaa
gaccctgaaaattataatcagatagaagccaaatttcaattgagtttaaaaactaagctc
attcaatcctttttattcggtcatggtgatatatggttaggttacactcagttagcaaat
tggcaagtttacaacgaccccatctcaagaccttttagagaattaaattatgagcctgaa
cttattgtcaactttccgctcaacatcactctatttgggctggatttgagaatggctggt
tttgcctttaatcatcaatccaatggtagagatttaccaagatctagaagctggaataga
ttagtattccatgccgctttcgaaagagataactttcaaatgtacctaagaccatggata
agaatagaaagttccgacaaggacgacaacccttctatagaaaattatataggtcgtctg
gaagccacttttatatataatataaataagcatagcttattagttattggaaaaaatgca
atggattttgatgaaaaccgagggagtttggaggttaactatttatattctgtaaaatct
aatcttagacttcacttacaagtatttactggctatggagaaaccttgatcgattataat
cacaagcaaacgaccattggtcttggagtttcctttatagactggtaa

DBGET integrated database retrieval system