KEGG   Psychroflexus torquis: P700755_000047Help
Entry
P700755_000047    CDS       T02275                                 

Definition
asparagine synthetase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ptq  Psychroflexus torquis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P700755_000047
Enzymes [BR:ptq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     P700755_000047
Peptidases [BR:ptq01002]
 Cysteine Peptidases
  Family C44
   P700755_000047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(47793..49367)
Genome map
AA seq 524 aa AA seqDB search
MCGIFVAIESAKSSQFLVDEFMKIKHRGPDSSDFKTIKENTYFGFHRLAINGLTPMGNQP
MYKNGVWLVANAEIFNYLELADKYDIKLETGSDCEILIDLYQLIGEEKMLQEIDGEFAFV
IYDESKDLYIAARDHLGVRGMYMGYDDSEIYFASEAKAILFSKELNQFPPGHYWNSYTDK
VTPYFFHDYDTTDLTEEEYCEKINTLLTRSVEKRMMSERPLGCLLSGGLDSSLVAGILAR
KLKEKGKQLETFSIGLEGSPDIVAAKIVADHIGSIHHSIVCTEQDFLDELEHTVYMLGSY
DVTTIRASVGHQLVAKYVRDHSDVKVLFSGETADEFGSYLYFQNAPDSESFQHESIRLLK
DIQFFDMKRADRSISNAGLEARVPFADKAFVKFFMSIPPESRLFSDQKIEKYLIRKAFEK
ENLIPEEILWRRKNGFSDSVSSKQKSWSTVIQEHVNTLVSDEEFQTEKFKYSPEPATKEA
YYYLKTFEYYYKSHFQLTPYQWLPKWCGDVKDPSARVLEIYQAD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatatttgtagctatcgaaagtgcaaaatctagtcaattcttagtggatgag
ttcatgaaaatcaaacaccgtggaccagactcctcagactttaagaccattaaagaaaat
acctattttggttttcatcgtttagccataaatggcttaacaccaatgggaaaccaaccg
atgtataaaaatggtgtttggctagtcgccaacgcagaaatatttaattatttagaatta
gcagataaatatgatattaagttagagacaggatcggattgtgaaattcttatcgattta
tatcaattgataggtgaagagaaaatgcttcaagaaatagacggggagtttgcttttgtt
atttatgacgaatccaaagatctatatatcgctgcacgagatcacttaggcgtgagaggc
atgtatatgggatatgacgactctgaaatttattttgcctcagaagccaaagctattctc
ttttcaaaagaattaaaccaatttcctccagggcattattggaattcctatacggataaa
gtgacaccttacttctttcatgattatgacactacagatctcactgaagaggagtactgt
gaaaaaatcaataccttattaactcgatctgttgaaaaacggatgatgagtgaaagacct
ctaggctgcttattaagcggagggttagatagcagtcttgtagcaggaatactggctaga
aaattaaaagaaaaagggaaacaattagaaacgttttctattggtttagaaggaagccca
gatattgttgctgccaaaatagtagcagatcatataggaagtattcaccatagcatcgtt
tgtacagaacaagatttcttagacgaactagagcatacagtgtatatgctaggaagttat
gatgtcacgactatacgcgcttcggtgggtcaccaacttgtcgccaaatatgtaagagac
cactccgatgtgaaagtcttattctctggagaaactgcagatgaatttggatcttatctg
tattttcaaaatgcaccagactcagaaagctttcagcatgaatccataagattgcttaag
gatattcagttttttgatatgaagagagcggataggtcaatttcaaatgcgggactagaa
gcaagagttccctttgctgacaaagcttttgtgaaattcttcatgtctatacctcctgaa
agcagactattttctgaccaaaaaattgaaaagtacctgatcagaaaagcttttgaaaag
gaaaacttaattccagaagaaatactatggcgtcgtaaaaacggattttcagatagtgtg
agcagtaagcaaaaatcatggagtacagtcatccaagaacacgtcaatactttagtctct
gacgaagaatttcaaactgaaaagtttaaatattctcctgaacccgcaacaaaagaagca
tattattatctcaaaacctttgaatattattataaatcacactttcaactcaccccttat
cagtggttgcctaaatggtgtggggatgttaaagatccttcagctagggttttagagata
tatcaagccgattaa

DBGET integrated database retrieval system