KEGG   Psychroflexus torquis: P700755_000068Help
Entry
P700755_000068    CDS       T02275                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ptq  Psychroflexus torquis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P700755_000068
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P700755_000068
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    P700755_000068
Enzymes [BR:ptq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     P700755_000068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(72724..74016)
Genome map
AA seq 430 aa AA seqDB search
MNFYSLNKQAPEVSFKEAVLKGLASDKGLYFPTSIKPLPNSFFESIGDLSYEEIAFEAIH
QFVTAEISNEDLKRIISETLSFDFPVVTLDKNISSLELFHGPTMAFKDVGARFMSRCLRL
FHSEQKNDITVLVATSGDTGGAVANGFLGVKGVKVVILYPKDKVSKVQEKQLTTLGQNIT
ALEVDGFFDDCQDMVKKAFLDRQITDHIQLTSANSINVARWLPQMFYFFFAYKQLYKNHK
KIVFSVPSGNFGNICAGLMAQKLGLPIHHFIAANNTNQVVTDYLETENYQPKPTVQTISN
AMDVGNPSNFIRIQELFKNEFSNLKAHLSSSSFSDSSTVEGIKELYSDYNYIADPHGAIG
FLAAKEYQQKYPDTHCVFLETAHPSKFLETVEKAIDTKVELPSQIKAVINKEKKSIKIST
YDELKSILLN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttattcactcaacaaacaagccccagaagtaagttttaaagaagcggtcctc
aaaggactagcatcagataaaggcttatattttccaacctcaataaaaccattaccaaat
tcatttttcgaatccataggggatttatcttatgaagagattgcttttgaagctattcat
caatttgttacagcagaaatttcaaatgaggacttaaaacggattatttctgaaactctt
agtttcgacttccccgtggtgactttagataaaaacatatcttctctagagttatttcat
ggtccaacgatggcttttaaagatgttggcgcgaggtttatgtccagatgcctccggctt
tttcattctgaacaaaaaaatgatataacggttttggtggctacctccggagatacgggg
ggagcagtcgctaacggttttttaggcgtaaaaggtgtcaaggtggtcatactttaccct
aaggataaagtgagcaaagtacaggagaagcaactcactactttgggacagaatattacc
gcactggaagtcgatggtttttttgatgattgccaagacatggtgaagaaagccttttta
gatcgtcaaattacagatcacattcaactcacttcggctaattccatcaacgtggctcgc
tggttgcctcaaatgttttattttttctttgcttacaaacagctttataaaaatcataaa
aaaattgttttttctgtccctagcggcaattttggaaatatttgcgctgggcttatggca
caaaaattaggcttacctattcatcattttattgccgccaacaacactaatcaagttgtt
acggactatttggaaaccgaaaattaccagccaaaacctacagtacaaactataagtaat
gctatggatgttggtaatcctagtaattttattagaattcaagaactattcaaaaatgag
tttagcaatctcaaggctcacttgtcttcgagtagcttttcagatagttcaactgtagaa
gggattaaagagctttatagcgattataattatatagcagatccgcatggagctatcggt
tttttagctgcaaaagagtatcaacaaaaatatccagatacccattgtgtgtttttagag
accgctcatcctagcaaatttttggaaactgtagaaaaagctattgacacgaaagtagag
ctgccatcacagattaaggctgtgattaataaagagaaaaagtccatcaaaatctctact
tacgatgaacttaaatctattttactcaactaa

DBGET integrated database retrieval system