KEGG   Psychroflexus torquis: P700755_000134Help
Entry
P700755_000134    CDS       T02275                                 

Definition
glutamate 5-kinase ProB
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ptq  Psychroflexus torquis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ptq01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ptq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
151315..152085
Genome map
AA seq 256 aa AA seqDB search
MHSKRIVVKVGTNVMTNRNNRIVGPILKNLVRQIAYLYERDVITVLVSSGSAIAGKEVLG
SCSSDDKSIRRQVYSSVGQPRMMRHYYTMFHDFGMRCGQVLATKRDFAPGKYRENMINCY
EGLLKEGIVPIANEDDAVSLSMSMFSDNDELASLVSELVKADMLIMLTDIEGLYTGHPDH
EDSKVLRHVRVHDNVEKYVQENEKGEGEGRGGMESKLKIAKMTASKNIPTFIANGKDENI
IIDILEGREVGTKFTV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaaaacgtattgttgtaaaagttggaaccaatgtgatgaccaacagaaacaat
agaattgtaggtccaattctaaaaaacttagtgagacaaatcgcttatttatatgagcgt
gatgtcataacagttcttgtgtcttctggatctgccatagctggaaaagaagtcttaggg
tcatgttcttcagacgataagtctattagaagacaagtatattcttctgtaggacaacct
agaatgatgagacattattacacgatgtttcatgatttcgggatgcgttgtgggcaagta
ttagccactaaacgggattttgcacctgggaaatatcgcgaaaatatgatcaattgttat
gaaggccttttaaaagagggcatcgttccaattgccaatgaagatgatgcggtatccctt
tctatgtctatgttttccgataatgatgagttagccagtttagtttcagaattggttaag
gcagacatgttaattatgcttactgatatcgagggcctttatacaggtcatccagatcat
gaggattccaaagtgttaagacatgtaagagtccacgataatgttgaaaaatatgttcaa
gaaaatgaaaaaggagaaggtgaaggccgaggtggtatggagtccaagctaaaaatagct
aagatgaccgcaagtaaaaatattcctactttcatagccaacggaaaggatgagaatatc
attatagatatattagaaggtagagaagtcggtactaaatttactgtttaa

DBGET integrated database retrieval system