KEGG   Psychroflexus torquis: P700755_000134Help
Entry
P700755_000134    CDS       T02275                                 

Definition
(GenBank) glutamate 5-kinase ProB
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00330  Arginine and proline metabolism
ptq00332  Carbapenem biosynthesis
ptq01100  Metabolic pathways
ptq01130  Biosynthesis of antibiotics
ptq01230  Biosynthesis of amino acids
Module
ptq_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    P700755_000134
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    P700755_000134
Enzymes [BR:ptq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     P700755_000134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AFU67201
UniProt: K4IDK6
Position
151315..152085
Genome map
AA seq 256 aa AA seqDB search
MHSKRIVVKVGTNVMTNRNNRIVGPILKNLVRQIAYLYERDVITVLVSSGSAIAGKEVLG
SCSSDDKSIRRQVYSSVGQPRMMRHYYTMFHDFGMRCGQVLATKRDFAPGKYRENMINCY
EGLLKEGIVPIANEDDAVSLSMSMFSDNDELASLVSELVKADMLIMLTDIEGLYTGHPDH
EDSKVLRHVRVHDNVEKYVQENEKGEGEGRGGMESKLKIAKMTASKNIPTFIANGKDENI
IIDILEGREVGTKFTV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaaaacgtattgttgtaaaagttggaaccaatgtgatgaccaacagaaacaat
agaattgtaggtccaattctaaaaaacttagtgagacaaatcgcttatttatatgagcgt
gatgtcataacagttcttgtgtcttctggatctgccatagctggaaaagaagtcttaggg
tcatgttcttcagacgataagtctattagaagacaagtatattcttctgtaggacaacct
agaatgatgagacattattacacgatgtttcatgatttcgggatgcgttgtgggcaagta
ttagccactaaacgggattttgcacctgggaaatatcgcgaaaatatgatcaattgttat
gaaggccttttaaaagagggcatcgttccaattgccaatgaagatgatgcggtatccctt
tctatgtctatgttttccgataatgatgagttagccagtttagtttcagaattggttaag
gcagacatgttaattatgcttactgatatcgagggcctttatacaggtcatccagatcat
gaggattccaaagtgttaagacatgtaagagtccacgataatgttgaaaaatatgttcaa
gaaaatgaaaaaggagaaggtgaaggccgaggtggtatggagtccaagctaaaaatagct
aagatgaccgcaagtaaaaatattcctactttcatagccaacggaaaggatgagaatatc
attatagatatattagaaggtagagaagtcggtactaaatttactgtttaa

DBGET integrated database retrieval system