KEGG   Psychroflexus torquis: P700755_000203Help
Entry
P700755_000203    CDS       T02275                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ptq  Psychroflexus torquis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ptq01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ptq00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(220846..222471)
Genome map
AA seq 541 aa AA seqDB search
MKNLPQTNYSSALQTVRTLKEKYGESWNAIHPESVARMATQNRFKTGLDIAIYTAAIMRK
DMAAYDADSSKFTQSLGCWHGFVAQQKMIAIKKHHKTTSKKYLYLSGWMVAALRSEFGPL
PDQSMHEKTAVPALISEIYDFLRQADAIELNDLFKRLERGEDVQDQIDNFETHVVPIIAD
IDAGFGNEEATYLLTKKMIQAGACAIQIENQVSDAKQCGHQDGKVTVPHEDFIAKLNAIR
YAFLELGVEDGIIVARTDSEGAGLTQKLPVSQEPGDLASQYLAFVEAEEIDVKEAKQDDV
LLKRDGKLVRPLRLANGLYKFKEGSNIDRVVLDCITSLQNGADLLWIETPTPNVKQIAHM
VNRIKEVVPTAKLVYNNSPSFNWTLNFRHQVYEEMLAEGENMTAYDRNNLMDSHYDATEL
CYRADEKIKTFQTDSARDAGIFHHLITLPTYHTTALHMNDLTKGYFSEEGMLAYVKGVQR
QEIRNKVSCVKHQRMAGSDLGDDHKSFFAGDKAIKAGGGKNTSNQFEIDKKVEKRELVTD
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaccacaaacaaattacagctctgcattacagactgtaagaacccttaaa
gaaaagtacggagagagttggaacgccatacatcctgaaagcgtagctagaatggctact
cagaatcgttttaaaacaggtttagacatcgccatatatacagcagccatcatgagaaaa
gatatggcagcttacgatgcagattcgtctaaatttactcaatctcttggttgctggcat
ggttttgtagcgcagcaaaaaatgatagctattaaaaagcatcacaaaacgaccagtaaa
aagtatttatatctttctggttggatggttgctgcgttacgttcagaatttggaccactg
ccagatcaatctatgcacgaaaaaacagcagttccagctttgataagtgaaatttatgac
ttcttacgccaagccgatgctattgagttaaatgatttatttaaaagacttgaaagagga
gaagatgtgcaagatcaaattgacaattttgagacccatgtagttcctattatagctgat
atcgatgctggttttggaaacgaagaagcaacctacttgttaaccaaaaaaatgattcaa
gctggtgcttgtgctattcagattgaaaatcaagtttctgatgccaaacaatgtggtcat
caagatggaaaagtaactgtgcctcatgaagattttattgcgaagctaaatgcgattaga
tacgcgtttttagaattaggtgtagaagatggaattatagtcgctagaacagattctgaa
ggagctggtttaactcaaaaattgcccgttagtcaagaacccggagatttagcttctcaa
tatttagcctttgtagaagccgaagaaattgatgtaaaagaggccaaacaagatgatgtc
cttcttaaaagggatggcaaattagtgagacctttaagactagccaatgggttgtataaa
tttaaagagggatctaatatagatagagttgtattagattgtattacaagtcttcaaaac
ggggcagatcttttatggattgaaacgccaactccaaatgtgaaacagattgcacatatg
gtaaacagaatcaaagaagtggttcctacggctaaattggtttacaataactcgccctct
tttaactggacattaaacttccgtcatcaagtctatgaagaaatgcttgcagaaggtgaa
aatatgacagcttatgataggaataatctaatggattcacactatgatgctacagaatta
tgctatcgtgcagatgagaaaattaagaccttccaaacagatagtgcaagagatgcaggg
attttccatcacctaattactttaccaacctatcatactaccgctcttcatatgaatgac
ttaaccaaaggatatttttcagaagaaggcatgttggcttatgtaaaaggggtacagaga
caagaaatccgtaataaggtttcttgtgttaaacatcaacgtatggcaggatctgactta
ggagacgatcacaaaagtttttttgctggagacaaagctataaaagcaggaggaggaaag
aatacaagtaatcagtttgaaattgataaaaaggttgaaaaaagagaacttgttacagat
aaataa

DBGET integrated database retrieval system