KEGG   Psychroflexus torquis: P700755_000204Help
Entry
P700755_000204    CDS       T02275                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ptq  Psychroflexus torquis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P700755_000204
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P700755_000204
   00630 Glyoxylate and dicarboxylate metabolism
    P700755_000204
Enzymes [BR:ptq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     P700755_000204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(222615..224213)
Genome map
AA seq 532 aa AA seqDB search
MEHTHLKQPKLNFSKDVINYYPDILTDEALNFLTLLHEKFNSERLDLLNNRLEQQKLFDK
GHFPEFPKETEAIRKGEWTAGNIPHDLQDRRVEITGPVDRKMIINALNSGTKTFMADLED
STAPSWKNTIEGQQNLIDANDKTISLLDSKRGKSYNLNQETAVLMVRTRGLHLNERHIII
NDQESSGSLTDFGLYVFHNVKTMLENGTAPYFYLPKLEHYLEARWWNKVFEFAQDYLDVP
VGTFKATVLIETITASFQLDEIIFELKDHIVGLNCGRWDYIFSYIKKFRNHPNFVVPNRD
QVTMTTPFMDAYSKLVIQRCHKRGILAIGGMAAQIPIKNDEKANTAALEKVRQDKEREVK
NGHDGTWVAHPALVEVAMEEFNKHMPMPNQLHITRDDINITEKDLVELPKGTVTEAGIRK
NINVGVLYTEAWLRGHGAVALYNLMEDAATAEISRTQVWQWLKNEVKLEDGRKFNMELYK
DLFNDEVEKIKAEFGEEHMKNSKFELAFNVFDELVVSEKFVEFLTLLAYKHI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacacacttaaaacaacccaaattaaatttttcaaaagatgtaattaattat
tatccagacattcttacagatgaagcgcttaactttttaacgttgcttcatgaaaaattt
aattcagagcgattagacttattaaataatcgcttagaacaacaaaaattatttgacaaa
ggtcattttcctgaattcccaaaagaaactgaagctattcgaaaaggggaatggacagct
ggcaatatcccgcacgatctacaagataggcgtgtggagattacaggtccagtagacaga
aaaatgataataaatgctttaaattctggaactaaaacatttatggcagatctggaagac
agcactgcacctagttggaaaaacactattgaagggcaacaaaatttaatagacgctaat
gataaaaccatttcattgctagattcaaaacgaggtaaatcttataatttgaatcaagaa
acagcagttttaatggtaagaactcggggtttacatttaaacgaaagacatatcataatc
aatgatcaagaaagttcaggaagtttaactgattttggcctgtatgtatttcataacgtc
aaaacaatgttagaaaatggaactgcgccctatttctacttaccgaaattagagcattat
ttagaagcgcgatggtggaataaagtgtttgaatttgcacaagactacctcgatgttcct
gtcggaacatttaaggcaactgttttaatagaaactatcacggcaagttttcagttagac
gaaatcatttttgaacttaaagatcacatcgtgggtttaaattgtggccgttgggattat
atattttcatacatcaaaaaattcagaaaccatccaaactttgtggtgccaaaccgtgat
caagtgactatgacaaccccttttatggatgcgtattctaaacttgtgattcaacgttgt
cataaacgtggtatccttgcgataggagggatggcagctcaaattccaattaaaaatgac
gaaaaagccaatactgctgctttagaaaaagttcgtcaagataaagagcgtgaagttaaa
aatggccatgatgggacatgggttgcacatcctgcattagttgaagtcgctatggaggaa
tttaataaacacatgccaatgccaaatcaattacatatcactcgtgacgacatcaacatt
acagaaaaagatttagttgaacttcctaaaggcactgtaacagaagccggaattagaaaa
aacattaatgttggggtactctatacagaagcttggttgcgaggtcatggcgctgtcgcc
ctctataatttaatggaagatgcagcgaccgcagaaatttcaagaactcaagtctggcag
tggttaaaaaatgaagtaaaactcgaagatggtagaaaatttaatatggaattatataaa
gacttatttaacgatgaagtcgaaaaaattaaggctgaatttggtgaagaacacatgaag
aacagcaagtttgaattggctttcaatgtttttgatgagttagttgtttcagaaaaattt
gtagagtttctaaccctcttagcgtataaacacatttaa

DBGET integrated database retrieval system