KEGG   Psychroflexus torquis: P700755_000359Help
Entry
P700755_000359    CDS       T02275                                 

Definition
aspartate carbamoyltransferase PyrB
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ptq  Psychroflexus torquis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    P700755_000359
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P700755_000359
Enzymes [BR:ptq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     P700755_000359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(380752..381690)
Genome map
AA seq 312 aa AA seqDB search
MKELSVSNLLGIKYLTTEDLHLIFETADQFKEIINRPIKKVPSLRDITIANLFFENSTRT
RLSFELAEKRLSADIINFSASSSSVTKGETLVDTVNNILAMKVDMVVMRHPNPGAGVFLS
KHIGASIINAGDGAHEHPTQALLDVYSIREKYGDVKGKKIVIIGDIMHSRVALSNIFALK
KLGAKVKVCGPNSLIPKHIESLGVEVEYNLAAALEWCEIANMLRVQHERMEHSYFPSTRE
YVQQYGVNKALLDTLSKPITIMHPGPINRGVEITSDVADSEHSIILNQVENGVAIRMAVM
YLLASKIKQYEN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacttagtgtttcaaatttactaggaataaaatatcttaccactgaagatctt
caccttatttttgaaactgcggatcagtttaaagaaatcatcaatagaccgattaaaaaa
gttccgagtttaagagatatcacaattgctaatctattttttgaaaatagtacccgtacg
cgtttgtcttttgaattggcagaaaagcgattgagtgcagacattattaacttttctgcc
tcctcttcctcagtaacaaaaggggaaaccttggtggatacagtcaataatattttggct
atgaaggtagatatggtcgtcatgcgtcatcctaaccctggagctggagttttcctttca
aagcatattggggcgagtattatcaatgcaggtgatggagctcatgagcatcctacacaa
gctcttttagatgtctattcaattcgagaaaaatacggtgatgtaaaaggaaagaaaatc
gtgattattggagatatcatgcattctcgagtcgccttgagcaatatatttgctttaaaa
aaattgggggctaaagtaaaagtttgcggtcctaattcgcttattccaaagcatattgaa
agcttaggggttgaggttgaatacaaccttgcagctgctctagagtggtgtgaaattgct
aatatgcttagagtacagcatgaacgaatggaacattcttattttcctagtaccagagaa
tatgttcagcaatatggagttaacaaagctcttctcgatactcttagcaaacctatcacg
attatgcatcctggccctattaatagaggcgttgagattactagtgatgtagccgattct
gaacattccataatccttaatcaagtagaaaacggtgtcgctattcggatggcagtcatg
tatctattagcttcaaaaattaagcaatatgaaaactga

DBGET integrated database retrieval system