KEGG   Psychroflexus torquis: P700755_000407Help
Entry
P700755_000407    CDS       T02275                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ptq  Psychroflexus torquis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ptq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
424237..425064
Genome map
AA seq 275 aa AA seqDB search
MTINCKGRLLDLSTPKVMGVLNLTPDSFYDGGKFKNDKEALEQVEKNIQDGMDILDIGAY
SSRPGADHISEEEELKRQSSVLQQITKEFPDLIISIDTFRSEVAKASIDQGAHIINDISA
GNLDANMMDFIADSQVPYIMMHMRGTPQTMKSMTSYKHLVTDIISYFSKKVLEARAKGIN
DLLIDPGFGFAKTIDQNFELLNHLKALKSLNLPILSGISRKSTIYKTLNIDAKEALNGTT
ALNMVALMNGSSILRVHDVLEAKQCITLYQKLIEN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaattgcaaaggacgtttactcgatttatctacccctaaagttatgggtgta
ctcaatttaactcccgattctttttatgacggaggcaaattcaaaaatgacaaagaagct
ttagagcaagtagaaaaaaatattcaagacgggatggatattttagacattggagcttat
agctcaagacctggagcagaccacatcagtgaagaagaagaattaaagaggcagagttca
gttttacaacaaattaccaaagaatttccagaccttattatttccatagacactttcaga
agcgaagttgctaaagcaagtatagaccaaggtgctcatatcattaacgatatttctgct
ggaaatctagatgctaacatgatggatttcatagcagattctcaagttccttatattatg
atgcatatgagaggtacgccgcaaaccatgaaaagcatgacctcttataaacatctggtc
accgacataatttcttatttttcgaaaaaagttttagaagcaagagctaaaggaattaat
gatcttcttatagatccaggatttggtttcgcaaaaaccatagatcaaaactttgagcta
ttaaatcaccttaaagccttaaagagcttgaacctacctatactttctggaatttctaga
aaatctacaatctacaaaacattgaatatcgatgctaaagaagccttaaacggaacaact
gccctcaacatggtcgctcttatgaatggaagttctatcttaagggttcatgatgtgttg
gaagctaagcaatgcattaccttgtaccaaaaattaatcgagaattaa

DBGET integrated database retrieval system