KEGG   Psychroflexus torquis: P700755_000537Help
Entry
P700755_000537    CDS       T02275                                 

Definition
phosphodiesterase/alkaline phosphatase PhoD-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ptq  Psychroflexus torquis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    P700755_000537
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    P700755_000537
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    P700755_000537
Enzymes [BR:ptq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     P700755_000537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(562368..563426)
Genome map
AA seq 352 aa AA seqDB search
MMKKIHWILTLAVILFASCKPNTSDKKTESEPIEIQPKTFRIAIGSCNRQDLPQEYWSII
EKDSADIFVWGGDNIYADTPNMDLMGEKYDSIKSDPYYQSFIKSLPNAPLGVWDDHDYGK
NDAGKEWPYKEEAKELFLDFLDIDSTQAVANRGGTYYSKVIALGNKSIKFYMLDSRYFRD
GLVKAEVPGKRYQPHTSKDSSLLGEQQWRWLENEFKSSKANFNIIVSSIQFLSSEHGFET
WGNFPNEIEKMQNLWLEYPLQNIFLLSGDRHISEFSQKKIDGLAYPLTDFTSSGLTHSYS
SYSGEPNQYRVGEVVAQTSYGIIDLNLVTEEAELRIKSTTDGHTISELHLDF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaatacattggattcttactttagcagtgatcttgtttgcatcgtgtaaa
ccgaacaccagtgataaaaaaacagaaagcgaacctattgaaattcaacctaaaaccttt
agaatagccattggcagttgcaatcgtcaagatttacctcaagagtattggtctattata
gagaaagattcggcagatatctttgtgtggggtggggataatatttatgcagacacgcca
aacatggatcttatgggagaaaaatacgacagcataaagtcagatccctattaccaatct
tttataaagagcttaccaaatgctcctttaggagtttgggacgatcatgactacggcaaa
aacgatgcgggtaaagaatggccttacaaagaggaggcaaaagaactttttttagatttt
ttggatatcgattcaacccaagctgtggccaatagaggcggaacttattattctaaagtt
attgctttaggtaacaaatcgatcaaattttacatgctggatagtcgatactttagagat
ggattggtcaaggctgaggtgcctggtaaaagatatcaaccgcatacctctaaagattct
tcgcttttaggcgagcaacaatggcgatggctagagaatgagtttaaaagttcgaaggct
aattttaatattattgtgagcagcattcagtttttatccagcgagcatggctttgaaact
tggggtaacttcccgaatgaaattgaaaaaatgcaaaacttatggctcgagtatcccctt
caaaatatttttcttttaagtggtgacaggcatatttcagagttttcccaaaagaaaatt
gacggcctagcttatcctttaaccgactttacgtccagtggtctaacgcattcttatagt
agttatagtggtgagcctaatcaatatagagtaggcgaggttgttgcacaaacaagttat
ggtattatagatctaaacttggtcactgaagaagctgaactgagaattaaatctactaca
gatggacatacaattagtgaactgcacctagacttctaa

DBGET integrated database retrieval system