KEGG   Psychroflexus torquis: P700755_000546Help
Entry
P700755_000546    CDS       T02275                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase Pcm
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ptq  Psychroflexus torquis
Brite
Enzymes [BR:ptq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     P700755_000546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(571887..572528)
Genome map
AA seq 213 aa AA seqDB search
MEDSYRQQGKRKLLVELVREKGIKDEKVLQAINEIPRHLFMDSSFEDHAYQDKAFPIAAG
QTISQPFTVAFQTELLQVERGDLILEVGTGSGYQAAVLCELGAKVYTIERQQKLYKKTKN
FLQKLGYRPKFMSFGDGYKGLPEYAPFDKIIVTAGAPFIPKPLMSQLKIGGRLVIPVGED
PQIMTLLKRTSAKSFQKETFGEFRFVPLLEDKN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttggaagacagttatagacagcaaggaaaacgtaaattactagtagaattggtccgagaa
aagggaattaaagatgaaaaagtccttcaagcgataaatgaaattcctagacaccttttt
atggatagcagttttgaagatcatgcttaccaagataaggctttccctatcgctgccgga
caaacaatctctcagccatttacggtcgcttttcagactgagcttttgcaggtagaacgc
ggtgatctaattttggaagtagggacgggaagcggttaccaagccgccgttttatgcgaa
ctgggagcaaaagtatataccatagaaagacaacaaaaactgtataagaaaactaaaaac
tttcttcaaaaactaggctacagacctaaatttatgagttttggagatgggtacaaaggt
ttgccagagtacgcccctttcgataaaattatcgtgactgctggggcgccttttataccc
aaacctttaatgtctcaattgaaaattggaggtagacttgtgattcccgttggggaagac
ccacaaattatgactttattgaaaaggacttctgctaaaagctttcaaaaagaaaccttt
ggcgaatttcgttttgtgccactcttggaggataaaaattag

DBGET integrated database retrieval system