KEGG   Psychroflexus torquis: P700755_000691Help
Entry
P700755_000691    CDS       T02275                                 

Definition
nitrous-oxide reductase NosZ
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ptq  Psychroflexus torquis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    P700755_000691
Enzymes [BR:ptq01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     P700755_000691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
731373..733337
Genome map
AA seq 654 aa AA seqDB search
MKTIQKLLLGLGAGLLLIGCGNNSKSDSGAMASSNAEKVYIAPGEHDEFYAFMSGGYSGN
LTVYGLPSGRMFKEIPVFSQFPTNGYGYSEETKAMLNTSYGFVPWGDSHHPDISQTNGKL
DGRWIFINENNTPRIARISLETFETEEIIEIPNSAGNHASSYVTENTEYVVAGTRFAVPN
PQKDMPIDEMKGEFKGPLTFIKVDPEHGHMEIDFQINMPGFNYDLSHPGRDKSHGWFFFT
SYNTEEAHSMLEVNASQNDKDFIAAVNWMKIKEYVENGGGTEVAGTYAHNIYDESTMMAT
TEMKEGVTSVDPRDVPGAVYYMPVPKSPHGIDVNPTGEYIIGNGKLSTQLSVYSFAKIEE
AIKNKDFDGDAYGIPILKFESVLEGVVDSGGLGPLHTEFDGKGYGYTSFFISSEVVKWEV
GTWKVVDRQPSFYSVGHLTIPGGNSREPFGKYMFSMNKITKDRYLPTGPELEHSAQLYDI
SGDKMQLLLDFPTHGEPHYAAAIPADLIKSKSKKYYDLEENNHKYAAKNESEGRVERKGN
EVHIYTTTVRSHFSPDNIEGVKVGDKVYFHVTNLEQDFDVPHGFAMIGANTSEILVMPGQ
TKTIIWEPKREGVWPFYCTDFCSALHQEMQGYVRVSAKNSDTKLRWSLDDEWKE
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattcaaaaacttttactaggtctaggtgcaggactactgcttataggttgt
ggtaataattcaaaatcggactctggtgctatggcatcatctaatgcagaaaaagtatat
attgctccaggtgagcacgacgaattttatgccttcatgtcgggaggatattccggaaac
ttgacagtttacggtttaccaagcggaagaatgtttaaagaaatacccgttttttctcaa
tttcctaccaacggatatggatattctgaagaaaccaaagctatgcttaatacttcttat
ggctttgtgccttggggtgattctcaccacccagatatttcccaaacaaacggaaaattg
gatggtcgatggattttcataaatgagaacaatacacctcgtattgctagaataagctta
gagactttcgaaaccgaagagattatcgaaattcctaactctgctggaaatcacgcctca
tcgtatgtgactgaaaatacagaatatgttgtagcagggactcgttttgctgttccaaat
cctcagaaagacatgcctatcgatgagatgaaaggtgaatttaaaggccctttaaccttt
attaaggttgatccagaacacggacacatggaaattgatttccaaataaatatgcctggc
ttcaattacgatttatcacatcctggtcgtgacaaatctcatggatggtttttcttcacc
tcttataatactgaagaagcacattctatgctagaagtgaatgcttcacaaaacgataaa
gattttatcgccgctgtaaattggatgaaaattaaagaatatgttgagaatggtggtgga
actgaagtggctggtacttatgcacataacatttacgatgaatcaaccatgatggccacc
acagaaatgaaagaaggcgtaacttcagttgatccgcgtgatgttccaggtgctgtctat
tacatgccagttccaaaatcacctcacggtatagatgttaacccaacaggcgaatacatc
attggaaatggaaaactatctacacagttaagtgtttattcatttgcgaaaattgaggaa
gccatcaaaaataaagactttgacggtgatgcctatggtatcccaatcttaaaatttgaa
tctgttcttgaaggtgttgtagatagtggtggtttaggcccattgcatactgaatttgat
ggaaaaggctacggttacactagcttctttatttcttctgaagttgtaaaatgggaagta
gggacttggaaagtagtagatagacaaccttctttctactcggtaggtcatttaactatt
cccggtggtaactcaagagaaccttttggtaagtatatgtttagtatgaataaaatcaca
aaggacagatatttaccaacaggtccagaattggagcattcagctcagttatatgatatt
tctggcgataaaatgcagttattactagatttcccaacacacggtgaacctcactatgca
gctgcgattcctgccgatttaataaaatctaaatctaaaaaatactacgatttagaagaa
aacaatcacaagtacgctgctaaaaatgaatctgagggacgtgtagaacgcaagggaaat
gaagttcatatttatactacaacagttagaagtcacttttcacccgataatattgaagga
gttaaagttggcgacaaggtatatttccacgttactaacttagagcaagattttgatgtt
cctcacggatttgcaatgattggagctaacacttcagaaattttggtcatgcctggacaa
actaaaaccattatttgggaacctaaacgggaaggtgtttggccattctattgtacagac
ttctgttctgcccttcaccaagaaatgcaaggttacgtaagagtttctgctaaaaatagc
gatactaaattgcgttggtcactagacgacgaatggaaagagtaa

DBGET integrated database retrieval system