KEGG   Psychroflexus torquis: P700755_001044Help
Entry
P700755_001044    CDS       T02275                                 

Definition
uroporphyrinogen-III synthase HemD
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ptq  Psychroflexus torquis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ptq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1110583..1111320)
Genome map
AA seq 245 aa AA seqDB search
MKVKSILISQPKPNVENSPYSELEERLKLKIDFIPFIHVEPVDSKEVRQQKIDITKFSAI
ILTSRNAVDHFFRIAEEMRYKIPDSLKYFCLSEAVAFYLQKYVVYRKRKIYVGKRTFQEL
EVSIKKHKDEKFLLPSSDMLKSMVPQQLDKLGVDWTRGIFYKTVVSDLSHLREVSYDIVV
FFSPSGIKSLYENFPDFEQKNTRIAAFGNSTIKAAEEKGLKVQIQAPTPKTPSMTMAIEN
YVKEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaaagtatccttatttcacagcctaaacctaatgtagaaaactctccttat
tcagaacttgaagaaagattaaaattaaaaattgatttcatcccctttatacacgttgag
ccagtagattctaaagaggtaaggcagcaaaaaattgacatcaccaagttttccgctatt
atccttacaagtagaaatgcagtagatcatttctttagaattgctgaagaaatgagatat
aaaataccagatagtcttaaatatttttgtttgagtgaagcggtagccttttacttgcag
aagtatgtagtgtatagaaagcgtaagatttatgttgggaaaagaacatttcaagaactt
gaagtaagtattaagaagcataaagatgaaaaattcttattgccttcctcagatatgctt
aagtctatggtgccacagcagctcgataaacttggtgtagattggacgcgtggcattttt
tataaaactgtggtaagcgatctttctcatcttagagaagtatcttacgatattgtggtt
ttctttagtcctagcgggattaagtcgctttacgagaatttcccagatttcgaacaaaaa
aatacacgcatcgctgcttttgggaactcaaccatcaaagccgccgaggagaaaggtcta
aaggtccaaatacaagctcctactccaaaaaccccatctatgacaatggccattgaaaac
tatgtaaaagagaactaa

DBGET integrated database retrieval system