KEGG   Psychroflexus torquis: P700755_001181Help
Entry
P700755_001181    CDS       T02275                                 

Definition
GMC oxidoreductase family protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ptq  Psychroflexus torquis
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    P700755_001181
Enzymes [BR:ptq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     P700755_001181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1236667..1238226
Genome map
AA seq 519 aa AA seqDB search
MEYDYIIIGSGFGGSVSALRLSEKGYKVLVIEKGKWYEAKDFPKTNWNFRKWLWIPFLRF
FGIMKLSVFKHIAIISGTGVGGGSLVYANTLPTPKSAFFNSGSWKDLKDWESELKPYYDE
ALRMLGATKNPELFDGDLGLQKVAENLDIKKKFAPTRVAVFFGKPGQTQKDPYFNGQGPE
RSGCNFCGACMTGCRHNAKNTLDKNYLYFAQKNGAEILAENEVYDVQPVATKDDSQGYNV
FLKSSTKLFSKRKTLKTKGVIFSGGVLGTVKLLLKLKKKSLPNLSDKLGEDIRSNNETLV
SVTGLDKDKNYSKGVAIGSILDTDENSHLEICRYGEGSDAWKLAHLPYVTGSNVVSRLFK
IFIKLLKHPIDYFKIYFVNGWAKNTVVLLFMQTLDSTLKFKRNALGQMTSTVSSGKAPTP
FIPESIKLVKAYRKAINGVSTSFSLETLAGIPSTAHILGGAVMGKNPSSGVIDKDNKVFN
YQNLYVIDGAMISANPGVNPSLSITAIAEHAMHQIPAKK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgattatattatcataggtagtggtttcggaggttcggttagtgctttgcga
ttatctgaaaagggatataaggttttagtcattgagaaaggcaaatggtacgaagccaaa
gatttccccaaaaccaactggaactttagaaagtggctatggataccctttttaaggttt
tttggtattatgaaactttccgttttcaaacatatcgccataatttctggtactggcgtt
ggaggaggctccttggtttacgccaacactttacctacccctaaatctgcttttttcaat
tctggaagctggaaggacttaaaggattgggaaagtgaattgaagccttattacgatgaa
gccttaagaatgttgggagctacaaaaaatccagaattgtttgacggagatttgggtctc
caaaaggtagccgaaaacttagacatcaagaagaaatttgccccaactcgtgttgccgta
tttttcggaaaacccggtcaaacccaaaaagacccctattttaatggccaagggccggaa
cgctctgggtgtaatttttgtggagcttgtatgacgggttgtagacataatgcaaaaaac
acactcgataaaaactacctctacttcgctcaaaaaaacggtgcagaaatactggccgaa
aatgaagtttatgatgttcaacctgttgccactaaagacgattctcaagggtataacgtc
tttttaaaaagcagcacaaaattattcagcaaacgcaagacactaaaaactaaaggggta
atattctcaggaggagttttgggtacagtaaaattactgctaaaacttaaaaagaaatcc
ctgcctaatttatcagataaactgggtgaagatatccgaagtaacaatgaaaccctagta
agtgttaccggactggacaaagacaaaaactattcgaaaggggttgccataggaagtatc
ctagacactgatgaaaacagtcatctcgaaatttgcagatatggtgaaggctccgatgct
tggaagctagctcatttaccatacgtgacgggatcaaatgtagtatcgcgtctgtttaaa
attttcataaaactcttaaaacatcccattgattatttcaagatttattttgtgaacggt
tgggccaagaacacagttgttttactttttatgcaaactctggacagtaccttaaaattt
aaacgaaacgctctggggcagatgacttcaaccgttagttcaggaaaggctcctacacct
tttatcccagaatctataaaactggttaaagcttaccgcaaagcgataaacggagtgagc
acctctttttctttagaaacattggcgggtataccgtctacagcacatattttaggggga
gccgttatgggaaagaatccttcttctggggtaatcgataaggacaataaagtttttaac
tatcagaacctttatgtgattgatggggctatgatttctgcaaatccaggagtaaatccc
tccttatccataactgctattgcagagcatgccatgcaccaaatacccgcaaaaaagtaa

DBGET integrated database retrieval system