KEGG   Psychroflexus torquis: P700755_001696Help
Entry
P700755_001696    CDS       T02275                                 

Definition
(GenBank) guanylate kinase Gmk
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00230  Purine metabolism
ptq01100  Metabolic pathways
Module
ptq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    P700755_001696
Enzymes [BR:ptq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     P700755_001696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_22 RsgA_GTPase cobW ABC_tran AAA_19 Rad17 TsaE AAA AAA_23
Motif
Other DBs
NCBI-ProteinID: AFU68550
UniProt: K4ISW2
Position
1810630..1811208
Genome map
AA seq 192 aa AA seqDB search
MGESKQGKLIVFSAPSGSGKTTIVRHLLSKEDLNLEFSISATSRSPREDEIDGKDYYFMD
LKAFKSYIKNDDFLEWEEVYRDNFYGTLNSEIDRIWAMGKHVVFDIDVVGGLDIKRIYPT
QTLAVFVEPPSIEELKIRLKKRKTESEDRIAMRVAKASIEMATAPQFDHIIVNEDLDKAL
DEAYHLVKDFIQ
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaatcaaaacagggcaaactcattgtattttctgctccatctggatctggcaaa
accactattgtaagacatctcttaagcaaagaggatctaaatctagagttttcgatttct
gcaacctctagatcaccaagagaagacgaaatcgacggaaaagattattattttatggat
ttgaaggcgttcaaatcctatattaaaaacgatgactttttggaatgggaagaggtgtac
agagataacttttacggaaccttaaattctgagatagatagaatctgggctatgggaaaa
catgtggtttttgatatagacgttgtgggggggttggatattaagcgtatttatcccaca
caaaccttagcggtattcgttgagcctccaagtatcgaagaacttaaaatccgacttaaa
aaaaggaaaacagagtctgaagatcgcattgccatgcgtgttgcaaaagcctctattgaa
atggccaccgctccacagtttgaccatattatagtcaatgaagatttggataaagctctg
gacgaagcctaccacttagtaaaagattttattcagtag

DBGET integrated database retrieval system