KEGG   Psychroflexus torquis: P700755_001821Help
Entry
P700755_001821    CDS       T02275                                 

Definition
glycerol kinase GlpK
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ptq  Psychroflexus torquis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    P700755_001821
Enzymes [BR:ptq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     P700755_001821
Exosome [BR:ptq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P700755_001821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1937561..1939057
Genome map
AA seq 498 aa AA seqDB search
MEKYILALDQGTTSSRAIVFNKKGKIYSVAQKEITQYFPKPGWVEHDPLEIWSKQAGVAA
EATTKKGLNGKNIAAIGITNQRETVVIWDKHTGDPIYNAIVWQDKRTSDYCDQLKADGKE
KMIQEKTGLVIDSYFSGTKVKWILDNVEGAREKANAGDLILGTMDSWLIWNFTKGELHVT
DVTNASRTMLFNIHTMDWDDDLLELFDIPKNMLPEVKDSSEVYGHTKTTVFASKIPIAGI
AGDQMAALFGQMCTEKGMVKSTYGTGCFMLMNIGDKPIISKNKLLTTVAWRINGKTEYAL
EGSIFIGGAVVQWLRDGLGIIKRSQDIENLAMSVESTDGVYFIPAFAGIGAPYWDQEAKG
TMFGITRGTTDAHIARASLEAIAYQTMDILKAMEADSEIDIGELRVDGGATVNDMLMQFQ
SDVLNTTTIRPKVTETTALGAAYLAGLAVGFWKDMEEIQATWKEDVKFQPTKDQDKIQDG
IKGWYRAINALQSWSKSK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatacattttggcattagaccaaggaacaacaagttcaagagcaattgtgttt
aacaagaaaggtaaaatctattctgttgctcaaaaagaaatcactcaatactttccaaaa
ccaggctgggtggaacacgaccctttagaaatttggtctaaacaagcaggtgttgctgct
gaagcaacaaccaaaaaaggactaaatggtaaaaatattgctgccataggaatcaccaac
caaagagaaacagtggtcatatgggataaacacactggagatcctatttataacgcaatt
gtttggcaagataaacggacctctgactattgtgaccagcttaaagcagacggtaaagaa
aagatgatacaagaaaagacaggtcttgtgatagattcctatttttcaggaactaaggtc
aaatggattctcgataatgttgagggagcaagagaaaaagcaaacgctggtgatcttatt
cttggaacaatggattcgtggttaatttggaactttaccaaaggggaactccatgtaact
gacgtgaccaacgcttctcgaaccatgctttttaatattcataccatggactgggatgat
gatctcttggaattatttgacattccaaaaaacatgctgccagaagttaaagattcaagt
gaagtgtatggacataccaaaaccacagtatttgcttccaaaattcctattgcgggtatt
gctggagatcaaatggctgccttgtttggtcaaatgtgtacagaaaaaggaatggtgaaa
agcacttatggaacaggctgttttatgctgatgaatattggtgataaacctattatttca
aagaacaaattattgactactgttgcttggagaattaatggtaaaactgagtatgcacta
gaaggtagtatttttataggtggtgctgtggtccaatggctaagagatggattgggaatt
attaaaagatcccaggatattgaaaacttagcgatgtctgtagagtctacagacggtgta
tattttattcctgcatttgctggtattggtgctccatattgggaccaagaagcgaaaggg
actatgtttggaattacaaggggaaccactgatgctcatattgcaagagcttctttagaa
gctatagcttatcaaactatggacatcttaaaagcaatggaggccgattccgaaatcgat
ataggagaattacgtgtggatggtggagccactgttaatgacatgttgatgcaatttcaa
tctgatgttttaaataccactactataagaccaaaagtaactgaaaccactgctttgggg
gctgcctatttagcgggattggcggttggtttttggaaagatatggaagaaattcaggcc
acctggaaagaagatgtcaaatttcaaccaacaaaagaccaagataaaattcaagacggt
atcaagggttggtacagagcgattaatgccctccaatcttggagtaaatctaaataa

DBGET integrated database retrieval system