KEGG   Psychroflexus torquis: P700755_002096Help
Entry
P700755_002096    CDS       T02275                                 

Definition
nicotinamidase PncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ptq  Psychroflexus torquis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    P700755_002096
Enzymes [BR:ptq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     P700755_002096
    3.5.1.-  
     P700755_002096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2251359..2251949
Genome map
AA seq 196 aa AA seqDB search
MKTLLIVDAQLDFMPGGGLAVENGDQIVSYINLVQPQYNLVVATQDWHPQHHISFASNHD
NYKPFQKKDIDGYRQTLWPDHCVQGDKGAEFHPNMRTNCIETIFRKGADPKIDSYSAFYD
NHHTKSTGLAGYLKDKGCKTMDICGLAGDICVYFTIKDALTEGFQVRVLEKATKALDQEK
FDQQKEELEAEGVVFL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccttacttatcgtcgatgctcagctcgattttatgccaggtggaggcctggcg
gtggaaaatggggatcaaattgtatcttatatcaatttggtccagcctcaatacaacttg
gttgtagcaactcaagattggcatccacaacaccatataagtttcgcctccaatcacgat
aattacaagccattccaaaaaaaagacatcgatggctatcggcaaaccttatggccagac
cactgcgtacagggggataaaggtgcagaatttcatcccaacatgagaaccaactgcatc
gaaacaattttccggaaaggggccgatcccaaaattgatagttacagcgctttttacgac
aatcaccatacaaaatccactggtcttgcaggatatctcaaagacaaaggctgcaagacc
atggatatctgtggattagctggcgatatttgcgtgtattttacgatcaaagatgccctc
accgaaggctttcaagtaagagttttagagaaagcaactaaggccttagaccaagagaaa
tttgatcagcagaaggaagaattggaagcagaaggggttgtatttctataa

DBGET integrated database retrieval system