KEGG   Psychroflexus torquis: P700755_002104Help
Entry
P700755_002104    CDS       T02275                                 

Definition
delta-aminolevulinate acid dehydratase HemB
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ptq  Psychroflexus torquis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P700755_002104
Enzymes [BR:ptq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     P700755_002104
Exosome [BR:ptq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P700755_002104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2262241..2263227
Genome map
AA seq 328 aa AA seqDB search
MFPLQRHRRLRQNDSIRSLIRETHLSPTDFIVPLFVVEGKGVKDEIDSMPNYYRFSLDLL
AKEVKELWQMGLKSVLLFVKVEDALKDNRGVEATNPDGLMQRAIKTVKNAAPEMLVMTDV
ALDPYSIYGHDGIVDQGKIVNDRTNSFLAQMALSHAQAGANFVAPSDMMDGRILEIRSVL
EDAHFMDTGIMSYSAKFASAFYGPFRDALDSAPVDVKGIPKDKKTYQMDFANRSEALKET
FSDIDEGADIVMVKPGLCYLDIVRDIANEVEVPVAVYQVSGEYAMLKAASARGWLDHDAV
MLEQLTAIKRAGASMIASYFAKDAVKLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtttccattgcaaagacaccgtcgcttaagacaaaacgattctatacgatcgctgata
agagaaacccatttaagcccaactgattttattgtccccttatttgtagttgagggaaaa
ggcgtaaaagatgaaatcgattccatgcctaattattataggtttagtttggatttgctc
gccaaggaagtcaaagaactttggcaaatgggattgaagtcagttttgctttttgtaaaa
gtcgaagacgctttaaaagacaatcgtggtgtagaagctacaaaccctgatggattgatg
cagcgagcgataaagaccgtaaagaatgcagctcccgaaatgttggttatgaccgatgtg
gctttagatccctactctatttatggacacgacggtattgtcgatcaagggaaaatagta
aacgatagaaccaattcttttcttgctcaaatggctctaagccatgctcaagctggagcc
aattttgttgcccctagcgatatgatggatggaagaatcttagagattcgaagtgttttg
gaagatgctcattttatggataccggcattatgagctattcagctaagtttgcctctgct
ttttatggtccatttagagatgctctagattctgctccagtggatgttaaaggtattcct
aaggataagaagacgtatcaaatggattttgccaataggagtgaagctttaaaagagacc
ttttcagatatcgatgaaggggcagatatcgtgatggtaaaaccaggactttgttacctg
gatattgtaagagatatagctaatgaagtggaagtgcctgtggctgtttatcaagtgagt
ggagaatatgcaatgctaaaagcggcttcagccagaggctggttagatcatgatgctgtg
atgctagaacaactcacagctattaagagagcaggggctagtatgattgcaagttatttt
gctaaagatgcggtcaaattactatag

DBGET integrated database retrieval system