KEGG   Psychroflexus torquis: P700755_002505Help
Entry
P700755_002505    CDS       T02275                                 

Definition
magnesium chelatase, subunit ChlI-like protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ptq  Psychroflexus torquis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P700755_002505
Enzymes [BR:ptq01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     P700755_002505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2687244..2688707)
Genome map
AA seq 487 aa AA seqDB search
MQLTALKTLGDLKSNSYISKSIKEELRDNLIHNLKNDKSSFEGIFGYEHTVIPQLEQAIL
SKHNINLLGLRGQAKTRIARQLLNLLDEYIPVVEGSEINDDPFHPVSLYAKELVEEKGDD
TPISWLHRSERFAEKLATPDVTVADLIGDIDPIKAANLKLSYADQRVIHYGMIPRANRCI
FVINELPDLQARIQVALFNILQEGDVQIRGFNLRLALDLQFVFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPKDIEIAKQITKQEAQLSDFKKENISVPDLARTLIEQISIEARQSHYV
DSKSGVSARLSITAFENLMSTAERRALVNGDHKTCLRLSDFNGIIPAITGKVELVYEGEE
EGTEFVAQQLIEAAILNLYPKFFPEIKKLEKQDEDQSYDKVLNWFMKNDDVQFFEDDSNA
EYESALDKIKPLEEMLNEYVSNYEKGEKYFWMEFILWGLSVHKKLDRNQVDTQLSFGDSF
GSFIKGL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgactgcactaaagacacttggtgatttaaaatccaattcttatatatccaaa
tctataaaagaggagttaagagataatctcattcataatttaaaaaatgataaatcttca
tttgaagggattttcggttatgaacacaccgttattccccaactagaacaggctatttta
tccaagcataatatcaatttactaggcttaagaggccaggccaaaacaagaatagcaagg
caacttttaaatctactggatgaatacatccccgtagttgaagggtctgaaatcaacgat
gatcctttccaccctgtttccttatatgccaaagaacttgttgaagagaaaggagatgac
acccctatttcttggttgcacaggagtgagcgtttcgccgagaaactagcgactccagat
gttactgtagcagacttgattggagacatcgatcctataaaagcggctaacttaaagttg
agttatgccgatcaaagggtcattcattatggtatgattcccagagcaaatcgttgcatt
tttgtcatcaacgaactcccagatttacaagctagaattcaagttgctcttttcaatatt
cttcaagaaggagatgttcaaataagaggtttcaacttaagattggcgttggatcttcaa
tttgtctttacagccaatccagaagattataccaaccgaggaagtattgttactccttta
aaagatagaataggctctcaaattttgacacactatcctaaagatattgaaattgctaag
caaatcaccaaacaggaagctcaactgtctgacttcaaaaaagaaaatattagtgttcca
gatttagcaagaaccttaatagaacaaatttctattgaagcaaggcagagtcattatgta
gattctaaaagtggtgtgagtgcacgactgagtattactgctttcgaaaacttaatgagt
acagcagaacggagagctcttgtaaatggagatcataaaacatgtctcagattaagtgat
ttcaatggtattataccagctattactggtaaggttgaattggtttatgaaggggaagaa
gaaggtactgaatttgttgctcagcaacttatagaagctgcaattttaaatctatatccc
aaattttttcctgaaatcaaaaaactagaaaaacaggatgaggaccagtcgtatgacaaa
gttttgaattggtttatgaagaatgacgatgttcagttttttgaagatgactctaatgca
gaatatgaatctgctctagataaaataaagcctttagaggaaatgctgaatgaatatgtc
tccaattatgaaaaaggtgaaaagtacttttggatggaatttatcctttggggcttatct
gttcataaaaaactagatagaaaccaagtcgatactcaactaagttttggtgattccttt
ggtagttttataaaaggtttataa

DBGET integrated database retrieval system