KEGG   Psychroflexus torquis: P700755_002514Help
Entry
P700755_002514    CDS       T02275                                 

Definition
pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase AceF
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ptq  Psychroflexus torquis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ptq01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ptq00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ptq00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ptq00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2701085..2702803
Genome map
AA seq 572 aa AA seqDB search
MAEVVNMPRLSDTMEEGVVAKWLKQKGDKVEEGEILAEIETDKATMEFESFHDGVLLHIG
VEEGEGAPVDTLLAIIGEEGEDISDLIKNSGKENSSDGKAEKTEAVDSTKSTSKEEAIED
TDEDDAEVPDGVEVVTMPRLSDTMEEGTVSTWLKSVGDDVKEGEILAEIETDKATMEFES
FYTGKLLYIGIGEGESAPVDDVLAVIGPEGTDVDKVLKSLKPEGKSSKSKSDSSSDKESE
SFSEETKEVPKASAPLELDVDENADNTDEQGRILASPLAKKIAEDKGIDLRKVSGSGDHG
RIVKKDVENFKPSVQPAEVKTEKVSIEEPKEQPSLPVAELYTPAGEESFEDVKNSQMRKT
IAKRLLESKNSAPHYYLNIEVDMENAMASRSHINEMPDVKVSFNDLVIKASAMALRKHPQ
VNSSWDGEVTKIANHIHVGVAVAVDEGLLVPVLEFADQQSLTQIGSNVKNLAGKAKNKKL
QPNEMEGSTFTVSNLGMFGITEFTSIINQPNSAILSVGTIVEKPVVKKGEIVVGHTMILT
LACDHRTVDGATGAKFLQTLKIYLENPVTMLA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagtaaatatgccaagacttagtgacaccatggaagaaggtgttgtcgct
aaatggctaaaacaaaaaggagataaggtagaggaaggcgaaattttagctgaaatcgaa
accgataaagcaacgatggagtttgaatctttccacgacggtgtgcttctgcatattgga
gttgaggagggtgaaggagctcctgtagatacccttctagccatcattggtgaagaagga
gaagatataagcgatcttattaaaaactctggcaaagaaaattcctctgatggaaaagct
gagaaaactgaagcagtggattctacaaaatccacttccaaagaagaagcaattgaagac
actgatgaagacgatgccgaagttcccgatggagtagaggtggttactatgccaaggcta
agtgacaccatggaagaaggaacagtctccacttggctaaagtcagtaggagatgatgta
aaagaaggcgaaattttagctgaaatcgaaaccgataaagcgacgatggaattcgaatct
ttctatacaggtaaacttctatatataggtataggtgaaggtgaatctgcaccagttgat
gatgttcttgcggttataggaccagaaggaacagatgttgataaagttttaaaatctctt
aaacccgaaggaaaaagttcaaaatcaaaatctgactctagttcagacaaagaaagtgaa
tcattttctgaagagactaaagaggttcctaaggcgtcagcaccactggagttagacgtt
gatgaaaatgcagataacacagatgaacaaggaagaatactagcctctcctttagctaag
aaaattgctgaagataaagggatagacctcagaaaggttagtggatctggtgatcatgga
agaatcgtgaagaaagatgttgaaaacttcaagccttcagtgcaaccagctgaagttaaa
actgaaaaagtttccatagaagaaccaaaagaacaaccttccttaccagtagctgaactg
tatactcctgctggggaagagtcatttgaagatgtgaaaaactctcaaatgaggaaaacg
atcgctaaacgattgttagaatctaaaaattctgctcctcattattacctcaatattgag
gtggatatggaaaatgccatggcttccagatctcatatcaacgaaatgccagacgttaaa
gtttcctttaatgatcttgtgattaaagcttctgcgatggcattgagaaaacaccctcaa
gtcaattcatcatgggatggtgaggtaactaaaatagcaaatcatattcacgttggtgta
gctgtagcggttgacgaaggtttacttgttcctgtattggaatttgcagatcaacagagt
ttaactcaaattggctccaatgtaaaaaaccttgccggtaaagcaaaaaataaaaaatta
cagcctaacgaaatggagggcagtacatttacagtttccaacttaggtatgtttggaatt
actgaatttacgagcattattaaccaacccaattctgcgattttatcagtaggtactatt
gtagagaagccagtggttaaaaaaggtgaaattgtagtaggacacaccatgattttaact
ttagcttgtgatcacaggactgtagatggagccacgggagcaaaattcttacaaactctt
aaaatctatttagaaaatccagtgacaatgctcgcttag

DBGET integrated database retrieval system