KEGG   Psychroflexus torquis: P700755_002554Help
Entry
P700755_002554    CDS       T02275                                 

Definition
tryptophan synthase beta chain TrpB
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ptq  Psychroflexus torquis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P700755_002554
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P700755_002554
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P700755_002554
Enzymes [BR:ptq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P700755_002554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2747662..2748846
Genome map
AA seq 394 aa AA seqDB search
MSKYSANDKGFYGDFGGAYIPELLYPNVEELRQNYKQIIATDDFQKQFKSLLKDYVGRPT
PLYLAENLSEKYKAKIYLKREDLCHTGAHKINNTVGQILLAKALGKHRIIAETGAGQHGV
ATATVCALMGLECIVYMGAVDIERQAPNVARMKMLGATVVPANSGSKTLKDATNEAIRDW
INHPRDTHYIIGSVVGPHPYPDMVTQLQSVISKEVKTQLLEKEGRELPDYLIACVGGGSN
AAGLFADFMDHEEVGIIGVEASGKGVETNESAATTILGREGIIHGSKTLLMQNTDGQITE
PYSISAGLDYPGIGPMHANLYKTGRGKFVSITDAEAMEAGLELSRIEGIIPAIETAHAFA
IFKYLDFKEDDVLVFNCSGRGDKDLDTYRTYFGY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtatagcgcgaatgacaaaggattttatggtgattttgggggggcttacatc
ccagaattattatatcctaatgtggaagaattaagacaaaactataaacagattattgct
acggatgattttcagaagcaatttaaaagtctattaaaagactacgtagggcggccaacg
cctttatatctagctgaaaatctcagcgaaaagtacaaggctaagatatacctgaagcgt
gaagatttatgtcacaccggcgcacataaaatcaataacaccgtagggcagatcctactt
gctaaggcattgggcaagcaccgcattatcgcggagacaggagcaggccagcatggggtg
gcaacagctacggtttgtgcattgatgggactggagtgtatcgtctatatgggagctgtc
gacatcgagcgtcaagcccctaacgtggcgaggatgaaaatgttgggagcgacggttgtc
ccagcgaattcaggaagtaaaaccttgaaagatgctactaacgaagcaattcgggattgg
attaaccatcctagagatacccattacattatcggttctgtggtaggaccgcatccgtat
cccgatatggtcactcagttgcaaagtgttatttccaaggaagtcaaaacgcagttgcta
gagaaggaaggtcgagaattaccagattacctcatcgcctgtgttggaggggggagtaat
gctgcgggattgtttgcggattttatggatcacgaagaggtagggatcatcggtgtagaa
gcctctgggaaaggagtggagacaaatgagtctgcggcgacaactattttaggtcgagaa
ggcatcatccacgggagtaaaaccttgctgatgcaaaataccgatggacaaatcaccgag
ccgtattctatttctgcaggactggactacccagggattggacctatgcacgcgaatctc
tataaaacggggcgtgggaaatttgtctctattactgatgcagaagctatggaagcaggc
ttagagttgagtcgtatagaagggattatccctgcgatagaaacggcacatgcttttgcg
attttcaagtatttggatttcaaagaagacgatgtgttggtctttaattgctcaggacgt
ggcgataaagatttagatacctacagaacgtatttcggatattaa

DBGET integrated database retrieval system