KEGG   Psychroflexus torquis: P700755_002555Help
Entry
P700755_002555    CDS       T02275                                 

Definition
(GenBank) tryptophan synthase alpha chain TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ptq  Psychroflexus torquis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P700755_002555
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P700755_002555
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P700755_002555
Enzymes [BR:ptq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P700755_002555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2748906..2749667
Genome map
AA seq 253 aa AA seqDB search
MNRINRALAQDKKLISIYFTAGYPQLEDTTEVIKRLTDSGTDVIEIGLPYSDPLADGPVI
QKSSEQALRNGMSTKKLFQQLEGIRDHVDIPLIVMGYFNAMLQFGVEDFCKECKAIGIDG
IIMPDLPIDIFEVDYKELFEAHGLKFIPLITPETSANRINTIDALGDSFVYMVSSSSTTG
GQQGFGDEALSYFKRIADMQLNNKLMVGFGIKDALSFEQASRYTSGCIIGSAFIQTLTEK
GLDGITGFIQSLK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattaatagagccttagctcaagataaaaaattgatttccatctatttcaca
gctggatacccgcagttggaagataccacggaagtcattaaacgccttactgattccggt
accgatgtgattgaaattggattgccgtatagtgaccctttggccgatgggcctgtgatc
caaaaaagctcagagcaagccttaagaaatggcatgagtaccaaaaaactatttcaacag
ttggaaggtattcgtgatcatgtggatattcctcttatcgtaatggggtattttaacgcg
atgttacagtttggagtggaagatttctgcaaagaatgtaaagctattggaattgatgga
attatcatgcccgatttacccattgatatttttgaagtggattacaaagaattatttgaa
gcacacggcttaaaatttattccgctcatcactccagaaacatctgcaaaccgaattaat
accatcgatgctttaggggatagttttgtctatatggtaagttcatccagtactactggt
ggccagcaaggttttggagacgaggccttgtcttattttaaacgcatagccgatatgcag
cttaataataagttgatggtaggctttggaatcaaagatgcgttgagttttgaacaagcc
agcagatatacaagtggttgtataattgggtcagcttttattcaaacccttaccgaaaaa
ggtttggacgggatcacagggtttattcagtcattgaagtag

DBGET integrated database retrieval system