KEGG   Psychroflexus torquis: P700755_003012Help
Entry
P700755_003012    CDS       T02275                                 

Definition
formamidopyrimidine-DNA glycosylase MutM
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ptq  Psychroflexus torquis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ptq03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3193743..3194525
Genome map
AA seq 260 aa AA seqDB search
MPELPEVQGYKTYIDSTSLHQRITEVDCRDTKLLKKPKADFDAYLYNQELIETQRIGKYL
FLKTTGKKILVMHFGMTGRPHYYKNEEDRPKFGHLELSFENGFHFAFENKRKFGWWDLID
SIADFKASHKLSDDARDLTLEDFKQSFNGRKTDIKKIIMDQSVAAGVGNWMADEILYQSK
IHPTKKVIEMTDTDIKSVFDAMKKVIEVAIENHAHYKDFPKTFLMHFRKEGATCYHTGAQ
IEKIKVGGRTTYFSPQWQEL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactaccagaagtacagggttataaaacctatatagacagcacctcattgcat
caacgcattaccgaagtagattgtcgggataccaaattactcaaaaagcccaaggcagat
ttcgacgcttatctttataatcaagaacttatagagacccagcgcattggaaaatatttg
tttcttaaaaccacagggaaaaaaatactggtcatgcattttgggatgactggccgccca
cactattataaaaatgaagaagatcgaccaaaatttggtcatttggagctaagcttcgaa
aatggatttcattttgcctttgagaataagcgaaagtttgggtggtgggaccttatagat
tctattgccgattttaaagcatcgcataaacttagcgacgatgctagagatttaacgctt
gaagattttaagcagtcgtttaatggtcgtaaaacagacattaagaaaattatcatggat
caaagtgttgctgcgggagtggggaattggatggcagatgaaattttataccagtcgaaa
atccatcctaccaaaaaagtgatagaaatgacagacacggatataaaaagcgtctttgat
gctatgaaaaaagtcattgaggttgccattgaaaatcacgcccattataaggatttccct
aaaacctttttgatgcactttagaaaagaaggagcgacctgttaccatacgggtgcccaa
atagagaagataaaagttggtggtagaacgacctatttttcgcctcagtggcaggaatta
tag

DBGET integrated database retrieval system