KEGG   Psychroflexus torquis: P700755_003056Help
Entry
P700755_003056    CDS       T02275                                 

Definition
glutathione peroxidase BtuE
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ptq  Psychroflexus torquis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    P700755_003056
  Metabolism of other amino acids
   00480 Glutathione metabolism
    P700755_003056
Enzymes [BR:ptq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     P700755_003056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3238989..3239474
Genome map
AA seq 161 aa AA seqDB search
MNSSIHQFLATDIKGDTFEFSNLKGKKVMIVNTASQCGLTPQYEKLQELYDTYKDSNFTI
IGFPSNDFMGQEPGSDSEISKFCLENYGVKFKMMGKIKIKGDDKHDVYQFLTDKEWNNRQ
DSSVEWNFQKYLLNGNGELEKVISPKTSPMDEEIVNWIKQD
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaactctagtatacaccaatttctagccacagatataaaaggcgatacctttgaattt
tcaaatcttaaaggaaaaaaagtaatgattgtaaacacagcttctcaatgtggacttact
cctcaatatgaaaagttgcaagaactttatgatacttataaagattctaatttcactatc
ataggctttccaagcaatgattttatgggacaagagcccggaagtgattctgaaatatca
aaattttgccttgaaaattatggtgtgaaattcaaaatgatgggaaagattaaaattaaa
ggggatgataaacatgatgtttatcaatttctaacggataaggaatggaataatagacaa
gatagttctgtagagtggaattttcaaaaatatcttttaaatgggaacggtgagcttgaa
aaagtaatttctccaaaaacatctccaatggatgaagaaattgtgaattggataaaacaa
gattag

DBGET integrated database retrieval system