KEGG   Psychroflexus torquis: P700755_003101Help
Entry
P700755_003101    CDS       T02275                                 

Definition
succinyl-CoA synthetase (ADP-forming) beta chain SucC
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ptq  Psychroflexus torquis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P700755_003101
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P700755_003101
   00640 Propanoate metabolism
    P700755_003101
   00660 C5-Branched dibasic acid metabolism
    P700755_003101
Enzymes [BR:ptq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     P700755_003101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3282079..3283272
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKEILSSFGVGIQKGILSKTPKEAVEAAKKLTEETGTGWHVIKAQVHAGGRGK
GGGVRLAKNLKEVEQIAEEILGMHLVTPQTSKEGKEVHQVLITEDVYYPGDNEPEEYYMS
VLLNRATGRNMIMYSPEGGVDIESVAENTPEKIFTEEIDPATGILPFQARKIAFNFGLEG
KAFKEMTKFVTSLYKAYEGCDSSLFEINPVLKTSDDRIIAVDAKVTLDDSALFRHKDYQN
MRDTREEDPTEVEAREAGLSYVNLDGNVGCMVNGAGLAMATMDLIKFAGAEPANFLDVGG
TADAKRVEQAFKLILKDKKVEAILINIFGGIVRCDRVAKGIIEAYKNMGDQINVPIIVRL
QGTNAEEAVKLINEAGINVETAVQFKEAADKVQKVLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacatgaatatcaaggcaaagaaatattaagcagttttggtgtcggcatccaa
aaaggaatcctttccaaaactcctaaagaagctgttgaagctgcaaaaaaactcactgaa
gaaaccggaaccgggtggcatgttataaaagctcaagttcatgcaggtggacgtggaaaa
gggggtggagttaggctcgccaaaaaccttaaagaggtggagcagatagcagaagagatt
ttaggaatgcatttggtaaccccacaaaccagtaaagaaggtaaggaggtgcatcaagtt
cttattacagaagacgtttattatccaggggataatgaaccagaagaatattatatgtct
gttttgttaaacagggccactggaagaaatatgattatgtattctccagaaggtggagtc
gatatagaaagtgtagcagaaaatacaccagaaaaaatctttactgaagaaatagatcct
gctacaggtattctaccatttcaagctcgtaaaattgctttcaactttggattagaagga
aaagcctttaaagaaatgaccaaatttgttacttctttgtacaaagcttacgaaggttgt
gattcttctttattcgaaatcaatcctgttttgaaaaccagtgatgacagaattatagct
gtagatgctaaagtaactttagacgattcagcgttatttagacataaagattatcaaaac
atgcgcgatacgcgtgaagaagatcctacagaagttgaagctagagaagctggtttaagc
tatgtcaacctagatggtaatgttggttgcatggtcaacggtgctggacttgctatggcc
actatggatttaattaaatttgctggagcagaaccggctaacttcctagacgttggaggt
actgccgatgcaaaacgtgttgaacaagcttttaaactaattctgaaggacaaaaaagta
gaagctatcttaatcaatatttttggaggtattgtaagatgtgaccgagtcgctaaaggt
attattgaagcttataaaaacatgggtgaccaaataaatgttcctattattgtaaggctt
caaggcaccaatgctgaagaagctgtgaaattgatcaacgaagctggaattaatgtggaa
actgcagttcaatttaaagaagctgcagataaagtacaaaaagttttagcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system