KEGG   Psychroflexus torquis: P700755_003101Help
Entry
P700755_003101    CDS       T02275                                 

Definition
(RefSeq) succinyl-CoA synthetase (ADP-forming) beta chain SucC
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ptq  Psychroflexus torquis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P700755_003101
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P700755_003101
   00640 Propanoate metabolism
    P700755_003101
   00660 C5-Branched dibasic acid metabolism
    P700755_003101
Enzymes [BR:ptq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     P700755_003101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3282079..3283272
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKEILSSFGVGIQKGILSKTPKEAVEAAKKLTEETGTGWHVIKAQVHAGGRGK
GGGVRLAKNLKEVEQIAEEILGMHLVTPQTSKEGKEVHQVLITEDVYYPGDNEPEEYYMS
VLLNRATGRNMIMYSPEGGVDIESVAENTPEKIFTEEIDPATGILPFQARKIAFNFGLEG
KAFKEMTKFVTSLYKAYEGCDSSLFEINPVLKTSDDRIIAVDAKVTLDDSALFRHKDYQN
MRDTREEDPTEVEAREAGLSYVNLDGNVGCMVNGAGLAMATMDLIKFAGAEPANFLDVGG
TADAKRVEQAFKLILKDKKVEAILINIFGGIVRCDRVAKGIIEAYKNMGDQINVPIIVRL
QGTNAEEAVKLINEAGINVETAVQFKEAADKVQKVLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacatgaatatcaaggcaaagaaatattaagcagttttggtgtcggcatccaa
aaaggaatcctttccaaaactcctaaagaagctgttgaagctgcaaaaaaactcactgaa
gaaaccggaaccgggtggcatgttataaaagctcaagttcatgcaggtggacgtggaaaa
gggggtggagttaggctcgccaaaaaccttaaagaggtggagcagatagcagaagagatt
ttaggaatgcatttggtaaccccacaaaccagtaaagaaggtaaggaggtgcatcaagtt
cttattacagaagacgtttattatccaggggataatgaaccagaagaatattatatgtct
gttttgttaaacagggccactggaagaaatatgattatgtattctccagaaggtggagtc
gatatagaaagtgtagcagaaaatacaccagaaaaaatctttactgaagaaatagatcct
gctacaggtattctaccatttcaagctcgtaaaattgctttcaactttggattagaagga
aaagcctttaaagaaatgaccaaatttgttacttctttgtacaaagcttacgaaggttgt
gattcttctttattcgaaatcaatcctgttttgaaaaccagtgatgacagaattatagct
gtagatgctaaagtaactttagacgattcagcgttatttagacataaagattatcaaaac
atgcgcgatacgcgtgaagaagatcctacagaagttgaagctagagaagctggtttaagc
tatgtcaacctagatggtaatgttggttgcatggtcaacggtgctggacttgctatggcc
actatggatttaattaaatttgctggagcagaaccggctaacttcctagacgttggaggt
actgccgatgcaaaacgtgttgaacaagcttttaaactaattctgaaggacaaaaaagta
gaagctatcttaatcaatatttttggaggtattgtaagatgtgaccgagtcgctaaaggt
attattgaagcttataaaaacatgggtgaccaaataaatgttcctattattgtaaggctt
caaggcaccaatgctgaagaagctgtgaaattgatcaacgaagctggaattaatgtggaa
actgcagttcaatttaaagaagctgcagataaagtacaaaaagttttagcttaa

DBGET integrated database retrieval system