KEGG   Psychroflexus torquis: P700755_003101Help
Entry
P700755_003101    CDS       T02275                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta chain SucC
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00020  Citrate cycle (TCA cycle)
ptq00640  Propanoate metabolism
ptq00660  C5-Branched dibasic acid metabolism
ptq01100  Metabolic pathways
ptq01110  Biosynthesis of secondary metabolites
ptq01120  Microbial metabolism in diverse environments
ptq01130  Biosynthesis of antibiotics
ptq01200  Carbon metabolism
Module
ptq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P700755_003101
   00640 Propanoate metabolism
    P700755_003101
   00660 C5-Branched dibasic acid metabolism
    P700755_003101
Enzymes [BR:ptq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     P700755_003101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Citrate_bind
Motif
Other DBs
NCBI-ProteinID: AFU69771
UniProt: K4IL01
Position
3282079..3283272
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKEILSSFGVGIQKGILSKTPKEAVEAAKKLTEETGTGWHVIKAQVHAGGRGK
GGGVRLAKNLKEVEQIAEEILGMHLVTPQTSKEGKEVHQVLITEDVYYPGDNEPEEYYMS
VLLNRATGRNMIMYSPEGGVDIESVAENTPEKIFTEEIDPATGILPFQARKIAFNFGLEG
KAFKEMTKFVTSLYKAYEGCDSSLFEINPVLKTSDDRIIAVDAKVTLDDSALFRHKDYQN
MRDTREEDPTEVEAREAGLSYVNLDGNVGCMVNGAGLAMATMDLIKFAGAEPANFLDVGG
TADAKRVEQAFKLILKDKKVEAILINIFGGIVRCDRVAKGIIEAYKNMGDQINVPIIVRL
QGTNAEEAVKLINEAGINVETAVQFKEAADKVQKVLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacatgaatatcaaggcaaagaaatattaagcagttttggtgtcggcatccaa
aaaggaatcctttccaaaactcctaaagaagctgttgaagctgcaaaaaaactcactgaa
gaaaccggaaccgggtggcatgttataaaagctcaagttcatgcaggtggacgtggaaaa
gggggtggagttaggctcgccaaaaaccttaaagaggtggagcagatagcagaagagatt
ttaggaatgcatttggtaaccccacaaaccagtaaagaaggtaaggaggtgcatcaagtt
cttattacagaagacgtttattatccaggggataatgaaccagaagaatattatatgtct
gttttgttaaacagggccactggaagaaatatgattatgtattctccagaaggtggagtc
gatatagaaagtgtagcagaaaatacaccagaaaaaatctttactgaagaaatagatcct
gctacaggtattctaccatttcaagctcgtaaaattgctttcaactttggattagaagga
aaagcctttaaagaaatgaccaaatttgttacttctttgtacaaagcttacgaaggttgt
gattcttctttattcgaaatcaatcctgttttgaaaaccagtgatgacagaattatagct
gtagatgctaaagtaactttagacgattcagcgttatttagacataaagattatcaaaac
atgcgcgatacgcgtgaagaagatcctacagaagttgaagctagagaagctggtttaagc
tatgtcaacctagatggtaatgttggttgcatggtcaacggtgctggacttgctatggcc
actatggatttaattaaatttgctggagcagaaccggctaacttcctagacgttggaggt
actgccgatgcaaaacgtgttgaacaagcttttaaactaattctgaaggacaaaaaagta
gaagctatcttaatcaatatttttggaggtattgtaagatgtgaccgagtcgctaaaggt
attattgaagcttataaaaacatgggtgaccaaataaatgttcctattattgtaaggctt
caaggcaccaatgctgaagaagctgtgaaattgatcaacgaagctggaattaatgtggaa
actgcagttcaatttaaagaagctgcagataaagtacaaaaagttttagcttaa

DBGET integrated database retrieval system