KEGG   Psychroflexus torquis: P700755_003156Help
Entry
P700755_003156    CDS       T02275                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase MurE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ptq  Psychroflexus torquis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    P700755_003156
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P700755_003156
Enzymes [BR:ptq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     P700755_003156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3323485..3324948
Genome map
AA seq 487 aa AA seqDB search
MIVLKDILYKVAIESVKGSTAVDIKKIHFDSRLISAQDVFVAIKGETADGHAFIEAAVAN
GANVVVCEELPSEVIPEVSYIQVKDCREALAVMASNYYDNPSANLKLIGVTGTNGKTTVT
SLLYQMFKTLGYKVGLISTVVIKVDDKDYPTKLTTPDSLTINSYLKEMNEVGVEFCFMEV
SSHGIAQHRTLGLNFEGGVFTNLSQDHLDYHKTFAKYRDVKKRFFDQLSKKGFALTNVDD
KNGNYMLQNTKAKTFGYGVKNLTDYKVKILEKSFSGLKLNINGTEVWSRFIGDFNAYNLL
AVYAVADLLEVKDIENLQNLSQLKPVEGRYQHHMSSTGIHVIVDYAHTPDALQNVLQTTN
DIRSRSEELITVVGCGGDRDTTKRPLMGKIAGNLSTKVILTSDNPRTEDPDSIIKDIEKG
VEPQDVSKTLSITSRQQAIKTACILAQQRDIILIAGKGHETYQEINGIRSDFDDLKIVKE
LLDQLNK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgatagttttaaaagacatattatacaaggtggcgatagaatctgtaaagggttctaca
gctgtagatatcaaaaaaatccattttgacagccgattaatttcagctcaagatgtattt
gtagctataaaaggcgaaactgcagatggtcatgcttttatagaagcggcagtcgctaat
ggtgctaatgtagttgtttgtgaagaattaccttctgaagttatcccagaagtgtcttat
atacaagtcaaagattgccgagaggcgttggccgtaatggcttccaattattatgataat
ccttctgctaatttgaagcttattggggtgactggaacaaatggtaaaacgacagtgact
tctttgttatatcagatgtttaaaactttaggctataaagtaggattaatttcaacggta
gttatcaaagtagatgacaaagattatccaacaaagcttacaactccagactccttaact
atcaattcttatttaaaagaaatgaacgaagttggggtagaattttgctttatggaagtg
agttctcatgggattgctcaacacaggactttaggccttaattttgaaggaggggttttt
actaacttatctcaagatcacttagattatcacaagacgtttgcaaaatacagagatgtt
aagaagagattttttgatcagttgtccaaaaaaggatttgctttaaccaatgtggatgat
aaaaatgggaattacatgctccaaaatacaaaagcaaaaacctttggttatggagttaaa
aacttaacagattacaaagtaaagattttagaaaaaagcttttctgggttaaagttgaat
atcaacggcacagaagtttggtcaaggtttattggagattttaatgcttataatttgctg
gctgtttatgcagtcgcagacttacttgaagttaaagatatcgagaatcttcagaacttg
agtcagttgaaacccgtggaggggagataccaacatcatatgtcttcaacgggcatacat
gtaattgtggattacgctcacacgcccgatgctttgcaaaatgtacttcagactaccaat
gatatacgatcacgaagtgaggagcttattactgttgtgggttgtggtggcgatcgcgat
accactaagcgtccccttatgggcaaaattgcagggaatttgagtacaaaagtgattttg
actagcgacaatccacgtacagaagatccagactctatcataaaagatattgagaaagga
gtagagcctcaagatgtttccaagacgttgagtataacatctagacaacaggccataaag
acagcttgtatcctagcgcaacaaagggacattatattaatcgcaggaaaaggtcacgaa
acctatcaagaaattaatgggatacgatcagattttgatgatttaaaaattgtaaaagag
ctattagatcaacttaacaaataa

DBGET integrated database retrieval system