KEGG   Psychroflexus torquis: P700755_003187Help
Entry
P700755_003187    CDS       T02275                                 

Definition
branched-chain alpha-keto acid dehydrogenase, dihydrolipoamide acyltransferase (E2 subunit)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ptq  Psychroflexus torquis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P700755_003187
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P700755_003187
  Amino acid metabolism
   00310 Lysine degradation
    P700755_003187
Enzymes [BR:ptq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     P700755_003187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3354218..3355564)
Genome map
AA seq 448 aa AA seqDB search
MAKKELKLPKMGESVAEATITAWLKEVGDTIEADEAVLEIATDKVDSEVPSEYDGVLVEK
LFDVDDVVKVGEVVAIIEVESEDSDENEGEASSTSEPEEVSENEIESASAIQDSVKSAKN
TTASASNYSDSSKFYSPLVKNIADKENISVEELDKIKGTGLDERVTKDDILTYIKTKKEG
GASAQKFVNEKSPEPKKAVETVAKPSTPVNINAGDEIMEMSRMGKLISSHMIASIQTSAH
VQSFIEVDVTDIWNWRGKHKGAFQEREGEKLTFTPIFMEAVARTIKDFPKINIAVDGDKI
IMKKHINLGMAATLPDGNLIVPVIRDADQLNLLGMAKKVNDLAGRARNGKLKPDETQGGT
YTVTNVGTFGSIMGTPIINQPQVGILAIGAIRKVPAVIETPEGDFIGIRYKMFLSHSYDH
RVVNGALGGQFIQRMKDYLEKFDTNQTI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaagaattgaaattacccaaaatgggagaaagtgttgctgaagcaacaatt
accgcttggttaaaagaagttggagataccatagaagctgatgaagctgttctcgaaatt
gctacagacaaagtagattctgaagttccaagtgaatatgatggtgttttagttgaaaaa
ttgtttgatgttgatgatgtagtcaaagttggcgaagtcgtagctattatagaagtagag
agtgaagattctgatgagaatgaaggggaagctagttctacctccgaacctgaagaagtc
tcagaaaatgaaatagaatctgcctctgctattcaagatagtgtaaaaagtgctaagaac
acaacggcttccgcatcaaattattcagactcttccaaattttattctccgctagttaaa
aatattgctgacaaagaaaatatttcggtagaggagttagataaaattaaggggactggc
ctagatgagcgagtgaccaaagacgatattctaacttatataaagactaaaaaagaaggt
ggagcttctgctcaaaaatttgttaatgagaagtctccagaacctaaaaaagcagtagaa
actgtcgctaaacctagtactcctgtgaatataaatgcaggtgacgaaataatggagatg
agtagaatgggtaaattgatttctagccatatgattgctagcattcaaacttctgcacat
gtgcaatcctttattgaggtagacgtcacagacatttggaattggagaggaaaacataaa
ggagcttttcaagaaagagaaggtgaaaaactcacctttactcctatttttatggaggcc
gttgctagaaccataaaagactttcccaagattaatatcgcagttgatggtgataaaatc
atcatgaaaaaacatatcaatttaggaatggctgcaactctaccagatggaaatttaata
gtccctgttataagagatgccgatcagcttaatcttttaggcatggccaagaaagtaaat
gaccttgcaggaagagccagaaatggaaagctgaaaccagacgaaactcaaggaggaact
tacactgtaaccaatgtaggaacttttggaagtataatgggcacaccgattatcaaccag
ccacaagtaggaatattggccataggtgctattaggaaagttcctgctgttattgaaacc
ccggaaggtgattttataggtatccgctataagatgttcttatctcacagttatgaccat
agagtcgttaatggtgctttaggtggacagtttattcaaaggatgaaagactacttagag
aaatttgataccaatcaaactatctaa

DBGET integrated database retrieval system