KEGG   Psychroflexus torquis: P700755_003189Help
Entry
P700755_003189    CDS       T02275                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ptq  Psychroflexus torquis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P700755_003189
DNA repair and recombination proteins [BR:ptq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      P700755_003189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3356770..3357393)
Genome map
AA seq 207 aa AA seqDB search
MDFSSKFLETAIEEIALLPGIGKRTALRLALHLLKQPQSQTTDLAKALVDLKTKVKQCKS
CHNISDKELCGICANQSRDHSIICIVEDIRDVMAIENTEQYKGIYHVLGGKISPMDGVGP
NQLNIESLVDKIKTGKVIEVIFALSSTMEGDTTNFYIYKQIQASKHSLKTSTIARGISIG
DELEYADEITLGRSILQRVPFENSLKN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcatctaagtttcttgagacagcaattgaagaaattgctttacttccgggt
attggaaagcgaactgcactacgtttggctttacaccttttaaaacaaccacagtctcaa
accacagatcttgcaaaagccttggtggatttaaagacaaaagtgaaacaatgtaaaagt
tgtcataatatctcagataaggagttatgtggaatttgcgcaaaccaaagcagagaccat
tctataatttgtatagttgaagatataagggatgtcatggctatcgaaaatacagaacaa
tataaagggatttatcatgtattgggtggaaaaataagtccaatggatggtgttggacct
aatcaattgaacattgaaagtctggttgataagattaaaactggaaaagttatagaagta
atttttgctctgagtagtaccatggagggagataccactaacttttatatttataaacaa
atacaagcctcaaaacactcgcttaaaacctctacaatagctagaggtatttcaattgga
gatgagttggagtacgcagatgaaattacgctaggaagaagcattcttcaacgcgtccct
tttgaaaattcattaaaaaactaa

DBGET integrated database retrieval system