KEGG   Psychroflexus torquis: P700755_003223Help
Entry
P700755_003223    CDS       T02275                                 

Definition
D-glucosyl-N-acylsphingosine glucohydrolase, putative
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ptq  Psychroflexus torquis
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    P700755_003223
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    P700755_003223
Enzymes [BR:ptq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     P700755_003223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3391101..3392600)
Genome map
AA seq 499 aa AA seqDB search
MKSLKILSINLIALMVISSCIETEKSLKVDVVETSRSGNKLSKVDVFSEGKPTSKINLNP
DKTFQTFTGFGGSFTESSAYLLNRLSKENRQKIIDAYFAESGARYSLTRTHMNSSDFSLG
QYSYAPVEGDTLLTSFSIKEDKDDIIPMIKEAMEASKEGFKIISSPWTAPPWMKDNNEWV
GGKLKPEHYDTWALFFSKYVDAYEAEGIDIWGFTVENEPHGNSNNWESMHYTPEEMTDFV
SNHLGPQLEKDGKGDKIILGYDQNREGIKEWVDVMYKNEKNAKYYDGTAIHWYESTFEVF
PEALQYAHEKAPQKYLIQTEACVDSEVPKWKDDDWYWSKEATDWGWDWAPEDQKHLHPKY
VPVYRYARDIIGCMNNWVDGWVDWNMVLDRQGGPNWFKNWCVAPVIVDPDQDEVYFTPLY
YTMAHFSKYIRPGAKRIDFESTDKDLQVSAATNPDGSHIVIVFNPSEEEKVFELSMKEAE
QVVSISPQAIQTIVLKPKK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtctgaaaattttatctataaacttaatagctctcatggtgattagttcttgt
atagaaacagaaaaatctttaaaggttgacgttgttgaaacctccagaagtggaaataaa
ctctctaaagtcgatgtctttagcgaaggaaaaccaacttctaaaatcaatttaaaccct
gataaaacgtttcaaacctttacgggttttggcggatcatttacagaatcttccgcttat
ttactgaatcgattgagtaaagaaaaccgtcaaaaaatcatcgatgcttattttgcggaa
agtggtgcacgatattcgttaacaagaactcatatgaactcaagtgatttctctttaggt
caatattcatatgcccccgttgaaggcgacaccttactgactagtttttctattaaagag
gataaagacgatattattcctatgattaaagaggctatggaagcctcaaaggaaggattc
aaaattatatcttctccttggactgctccaccttggatgaaagataataatgagtgggtt
ggtggaaaattaaagccagaacattacgacacttgggctcttttcttttctaaatatgtt
gatgcttatgaggctgaagggattgatatatggggttttactgtggaaaatgaaccacat
ggtaatagcaataattgggaaagcatgcactataccccagaagaaatgactgattttgtg
agcaatcaccttggccctcaattagaaaaagacggtaaaggcgataaaattattttagga
tatgaccaaaatcgcgaaggcattaaagagtgggtggatgtgatgtataagaatgagaaa
aatgctaaatattatgatggaactgccatacactggtacgaaagtacctttgaagtgttt
cccgaagctttgcaatatgcacatgaaaaagcaccccagaaatacttgatacaaactgaa
gcctgtgtggattccgaagttcctaaatggaaagatgacgactggtattggagtaaagaa
gcgacagattggggttgggattgggcccccgaagatcaaaaacacttacatccaaaatac
gttcctgtttatcgctatgctagagatattataggatgtatgaacaattgggttgatggc
tgggtcgactggaatatggtcttggaccgacaaggtggacctaactggtttaaaaactgg
tgtgtggctccagtcattgtagatcctgatcaagatgaagtctattttaccccactctat
tacaccatggctcatttcagtaaatacataagaccaggtgcgaaacgaattgatttcgaa
tctacagataaagacttgcaagtgagcgctgccacaaatccagatggaagtcatatcgtt
atcgtttttaacccttcagaagaagaaaaagtatttgaacttagtatgaaagaagcagaa
caagtagtttctataagccctcaagccattcaaactattgtattaaaacctaaaaaataa

DBGET integrated database retrieval system