KEGG   Psychroflexus torquis: P700755_003478Help
Entry
P700755_003478    CDS       T02275                                 

Definition
diheme cytochrome peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ptq  Psychroflexus torquis
Brite
Enzymes [BR:ptq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     P700755_003478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3670989..3672128)
Genome map
AA seq 379 aa AA seqDB search
MTLKIKHIYSFLILAGLIFIVLAFKANDKNESASYNDYDELRKLYGSGDQTLWPEPVLDP
SIDENKFQDLGTLLEVEFPESNPYSKEKAELGEQLFFEKRLSQSGQIACASCHDPSHAWA
DPNRKSKGHNGLEGNRNSMSILNTAYVKKLFWDGRVETLEEQVKFPIEDPREMNLSLDLA
VENIKNASGYIEKFENAFGTKHITAELISKAIATFERTKTSGFSKFDKFINGETNLFTDE
EVLGLHIYRTKANCISCHNTPLFSDNQFHNDGQSLFGSSHQDLGLFEKTKDSLDMGKFRT
PSLREVNETGPWMHNGNFLTLTEIIDYYNLGNPSPIQKKVLKEHKGTLPKTSTVLRNLRL
SDEEKSALIAFIKTLSSNF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacattgaaaattaaacacatttattcatttttaatacttgcaggtttaatttttata
gtcttagcttttaaagccaatgataaaaatgaaagtgcaagttataatgactatgacgag
ttaagaaagttatatggcagtggagaccagactctatggccagaacccgtattggatcct
agtatcgatgaaaataaattccaagaccttggaaccttacttgaagtagaatttccagag
tcgaatccttactccaaggaaaaggctgaacttggtgaacaacttttttttgaaaaacgc
ttatcccaaagtggacaaatagcatgtgcatcttgccatgatccctctcacgcctgggca
gatcccaatcgaaaatctaaaggtcacaatggattggaaggaaacagaaattctatgagt
atcttaaataccgcctatgtaaaaaaattattttgggatggcagagtagaaaccctagaa
gaacaagtgaaatttcctatagaagaccctagagaaatgaatttgtccttagatctagct
gtagaaaacataaaaaatgcctctgggtatatcgaaaaatttgaaaatgcttttggtacc
aagcacattactgcagaactcatttctaaagctattgctacttttgaaagaactaaaaca
agtggattcagtaaattcgataagtttataaatggtgaaactaatctgtttacagatgaa
gaagttttaggcttacatatttatagaactaaagctaattgtataagttgtcacaatact
cctcttttcagtgacaaccaatttcataatgatggtcaatctctttttggctccagccat
caagatttaggattatttgaaaaaacaaaggatagcttagatatgggtaaatttagaacc
ccaagtctaagagaagtcaatgaaactggtccttggatgcacaatggtaattttttgact
ttaacagaaatcatagattactataatttgggtaatccttcaccaattcaaaaaaaggtt
ttaaaagagcataaaggaactttaccaaaaacctctactgttctaagaaatctgagatta
tctgatgaagaaaaatctgcacttatagcatttataaaaaccttatcttcaaatttttag

DBGET integrated database retrieval system