KEGG   Psychroflexus torquis: P700755_003514Help
Entry
P700755_003514    CDS       T02275                                 

Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00010  Glycolysis / Gluconeogenesis
ptq00030  Pentose phosphate pathway
ptq00051  Fructose and mannose metabolism
ptq00052  Galactose metabolism
ptq00680  Methane metabolism
ptq01100  Metabolic pathways
ptq01110  Biosynthesis of secondary metabolites
ptq01120  Microbial metabolism in diverse environments
ptq01130  Biosynthesis of antibiotics
ptq01200  Carbon metabolism
ptq01230  Biosynthesis of amino acids
ptq03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P700755_003514
   00030 Pentose phosphate pathway
    P700755_003514
   00051 Fructose and mannose metabolism
    P700755_003514
   00052 Galactose metabolism
    P700755_003514
  Energy metabolism
   00680 Methane metabolism
    P700755_003514
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    P700755_003514
Enzymes [BR:ptq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     P700755_003514
Protein phosphatases and associated proteins [BR:ptq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     P700755_003514
Messenger RNA biogenesis [BR:ptq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     P700755_003514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat DDE_Tnp_2
Motif
Other DBs
NCBI-ProteinID: AFU70131
UniProt: K4IM40
Position
3728624..3729610
Genome map
AA seq 328 aa AA seqDB search
MSKKLTKIAVLTSGGDSPGMNAAIRAVVRNAAYCDLKCDGVYRGYQGLIENEFIELGPRD
VKNTINRGGTFLKSARSKGFMTKEGRQKAYDNLMARDVDALVVIGGDGTFTGASIFSKEF
DIPIIGIPGTIDNDINGTDYTIGYDTALNTVVEAIDKIRDTASSHDRLFLVEVMGRDAGD
IALNSGIGAGAEEILIPEENMGIERLLESLDKSRKTGKTSSIIVVSEGDQIGKNITEVAN
SIQTRLPDYEVKVTVLGHIQRGGSPSCSDRVLASRLGVGAVDALLEGYSNIMVGIEHKKI
VYVPFDTAINIKKVLDKDLIRVADIVSS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaattaactaaaatagctgttttaacatccggcggtgattcccctgggatg
aatgcagcaataagagcagttgtaagaaatgctgcttattgtgatctcaaatgtgacggt
gtttacagaggttaccaaggcttaattgaaaatgaatttatcgaattaggtccaagggat
gtcaaaaacactattaatagagggggtacttttctaaagtccgctcgttcaaaaggcttt
atgaccaaagaaggtcggcaaaaagcctacgataacttaatggctagagatgtagatgct
cttgtggttatagggggtgatggaacatttacaggggcttctatttttagtaaggaattc
gatattcctattattggtattcctggaaccatagataacgacatcaatggaaccgactat
actataggctatgatacagcgcttaatacagttgtcgaagccatagataaaattcgagat
acagcaagttctcacgatcgcttatttttggtagaagttatgggcagagatgctggcgat
atcgctttaaatagtgggataggtgcaggtgctgaagaaattctaattcctgaggaaaac
atgggcatagagcgtctgttggaatctcttgataaaagccgtaaaacgggtaaaacgtct
agcattatagtcgtctctgaaggagaccaaattggtaaaaatattactgaggtggcaaat
tctatccaaactaggcttccagattatgaagtaaaagtaactgtacttggtcatatccaa
cggggaggttctccaagttgctccgatagggttcttgccagtagattaggagtaggagct
gttgatgcattgctggaaggatattctaatattatggttggcatagaacacaaaaagata
gtttacgttccctttgatacggccattaatattaaaaaagtattagataaagatttgata
agagttgcagatattgtatcctcttaa

DBGET integrated database retrieval system