KEGG   Psychroflexus torquis: P700755_003601Help
Entry
P700755_003601    CDS       T02275                                 

Definition
triosephosphate isomerase TpiA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ptq  Psychroflexus torquis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P700755_003601
   01230 Biosynthesis of amino acids
    P700755_003601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P700755_003601
   00051 Fructose and mannose metabolism
    P700755_003601
   00562 Inositol phosphate metabolism
    P700755_003601
Enzymes [BR:ptq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P700755_003601
Exosome [BR:ptq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P700755_003601
  Exosomal proteins of bladder cancer cells
   P700755_003601
  Exosomal proteins of melanoma cells
   P700755_003601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3813558..3814310)
Genome map
AA seq 250 aa AA seqDB search
MRTQIVAGNWKMNCDLDESQHLLNALKQKDFSKSNAEVIVAPPFTNLYAAHKTLENSSIK
ISSQNINENDKGAYTGEISPSMLKSVGVEYAIIGHSERRAIYEESDDLLAKKVTAALKHD
LKVMFCIGEDLEKRKADKHFEVVEEQLKNGLFHIDASEMKDVVIAYEPVWAIGTGETASP
EQAQEIHEHIRKILAKQYSQEIADQTSILYGGSVKPNNAKEIFAKKDVDGGLIGGASLDA
DSFAEIVMSF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcaaattgtagcaggaaactggaaaatgaattgtgatttagatgaatcacaa
catcttttgaatgctttaaaacaaaaagatttttctaaatctaacgcagaagttattgtt
gcaccacccttcaccaacttgtatgcggctcacaagaccttagaaaattcttcaataaag
atttcatctcaaaacatcaatgaaaacgacaaaggcgcttatacaggagaaatctctcct
agtatgctgaaaagtgttggtgtagaatacgctatcattggacatagtgagcgaagagcc
atctatgaagaaagcgatgatttacttgcaaaaaaggtgactgccgctctgaagcatgac
cttaaagtgatgttctgtatcggtgaagacctagagaaaagaaaagctgacaaacatttt
gaagtggtagaagaacaattgaagaatggtctttttcatattgacgcttcagaaatgaaa
gatgtagtgattgcttatgaacccgtctgggccattggaacaggagaaacagcttctcca
gaacaagcccaagagattcatgaacacatccgcaagattttagctaaacaatacagccaa
gagattgccgatcaaacctctatcctttatggaggaagtgtcaaaccaaataatgctaaa
gaaatttttgctaaaaaagatgttgatggtgggcttatagggggtgcctctctagatgca
gatagttttgcagaaattgtaatgtctttctaa

DBGET integrated database retrieval system