KEGG   Psychroflexus torquis: P700755_003601Help
Entry
P700755_003601    CDS       T02275                                 

Definition
triosephosphate isomerase TpiA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ptq  Psychroflexus torquis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P700755_003601
   01230 Biosynthesis of amino acids
    P700755_003601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P700755_003601
   00051 Fructose and mannose metabolism
    P700755_003601
   00562 Inositol phosphate metabolism
    P700755_003601
Enzymes [BR:ptq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P700755_003601
Exosome [BR:ptq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P700755_003601
  Exosomal proteins of bladder cancer cells
   P700755_003601
  Exosomal proteins of melanoma cells
   P700755_003601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3813558..3814310)
Genome map
AA seq 250 aa AA seqDB search
MRTQIVAGNWKMNCDLDESQHLLNALKQKDFSKSNAEVIVAPPFTNLYAAHKTLENSSIK
ISSQNINENDKGAYTGEISPSMLKSVGVEYAIIGHSERRAIYEESDDLLAKKVTAALKHD
LKVMFCIGEDLEKRKADKHFEVVEEQLKNGLFHIDASEMKDVVIAYEPVWAIGTGETASP
EQAQEIHEHIRKILAKQYSQEIADQTSILYGGSVKPNNAKEIFAKKDVDGGLIGGASLDA
DSFAEIVMSF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcaaattgtagcaggaaactggaaaatgaattgtgatttagatgaatcacaa
catcttttgaatgctttaaaacaaaaagatttttctaaatctaacgcagaagttattgtt
gcaccacccttcaccaacttgtatgcggctcacaagaccttagaaaattcttcaataaag
atttcatctcaaaacatcaatgaaaacgacaaaggcgcttatacaggagaaatctctcct
agtatgctgaaaagtgttggtgtagaatacgctatcattggacatagtgagcgaagagcc
atctatgaagaaagcgatgatttacttgcaaaaaaggtgactgccgctctgaagcatgac
cttaaagtgatgttctgtatcggtgaagacctagagaaaagaaaagctgacaaacatttt
gaagtggtagaagaacaattgaagaatggtctttttcatattgacgcttcagaaatgaaa
gatgtagtgattgcttatgaacccgtctgggccattggaacaggagaaacagcttctcca
gaacaagcccaagagattcatgaacacatccgcaagattttagctaaacaatacagccaa
gagattgccgatcaaacctctatcctttatggaggaagtgtcaaaccaaataatgctaaa
gaaatttttgctaaaaaagatgttgatggtgggcttatagggggtgcctctctagatgca
gatagttttgcagaaattgtaatgtctttctaa

DBGET integrated database retrieval system