KEGG   Psychroflexus torquis: P700755_003601Help
Entry
P700755_003601    CDS       T02275                                 

Definition
triosephosphate isomerase TpiA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ptq  Psychroflexus torquis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ptq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ptq01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ptq00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ptq00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3813558..3814310)
Genome map
AA seq 250 aa AA seqDB search
MRTQIVAGNWKMNCDLDESQHLLNALKQKDFSKSNAEVIVAPPFTNLYAAHKTLENSSIK
ISSQNINENDKGAYTGEISPSMLKSVGVEYAIIGHSERRAIYEESDDLLAKKVTAALKHD
LKVMFCIGEDLEKRKADKHFEVVEEQLKNGLFHIDASEMKDVVIAYEPVWAIGTGETASP
EQAQEIHEHIRKILAKQYSQEIADQTSILYGGSVKPNNAKEIFAKKDVDGGLIGGASLDA
DSFAEIVMSF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcaaattgtagcaggaaactggaaaatgaattgtgatttagatgaatcacaa
catcttttgaatgctttaaaacaaaaagatttttctaaatctaacgcagaagttattgtt
gcaccacccttcaccaacttgtatgcggctcacaagaccttagaaaattcttcaataaag
atttcatctcaaaacatcaatgaaaacgacaaaggcgcttatacaggagaaatctctcct
agtatgctgaaaagtgttggtgtagaatacgctatcattggacatagtgagcgaagagcc
atctatgaagaaagcgatgatttacttgcaaaaaaggtgactgccgctctgaagcatgac
cttaaagtgatgttctgtatcggtgaagacctagagaaaagaaaagctgacaaacatttt
gaagtggtagaagaacaattgaagaatggtctttttcatattgacgcttcagaaatgaaa
gatgtagtgattgcttatgaacccgtctgggccattggaacaggagaaacagcttctcca
gaacaagcccaagagattcatgaacacatccgcaagattttagctaaacaatacagccaa
gagattgccgatcaaacctctatcctttatggaggaagtgtcaaaccaaataatgctaaa
gaaatttttgctaaaaaagatgttgatggtgggcttatagggggtgcctctctagatgca
gatagttttgcagaaattgtaatgtctttctaa

DBGET integrated database retrieval system