KEGG   Psychroflexus torquis: P700755_003731Help
Entry
P700755_003731    CDS       T02275                                 

Definition
multifunctional acyl-CoA thioesterase I/lysophospholipase, putative
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ptq  Psychroflexus torquis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    P700755_003731
Enzymes [BR:ptq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     P700755_003731
   3.1.2  Thioester hydrolases
    3.1.2.-  
     P700755_003731
Lipid biosynthesis proteins [BR:ptq01004]
 Fatty acid synthase
  Component type
   P700755_003731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3956587..3957339)
Genome map
AA seq 250 aa AA seqDB search
MSEAQNRQMNLILPTSAMQKLIRLCYIIPLILILGCGSDKKKKTTQEETATQQTKPSQLA
EASENNTETILCFGDSITAGYGLEDSNDAFPAVLQEKIDSLNLKYIVVNSGLSGETTAGG
KSRIDWVLNQDIDIFLLELGANDGLRGVPLSETRSNLQAIIRTVKEKSPKTKVILAGMQL
PPNMGQKYTTEFRELFSELAEANNLAFIPFILKDVGGIAELNQSDGIHPTVDGHKIVAHT
VWEVLKPMLE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggctcaaaatagacaaatgaatctaatcttaccaacttccgctatgcagaaa
ctcataaggctttgttatattattcccttgattttaatcttgggttgtggtagtgataaa
aagaaaaaaacgacacaagaagaaacagcaacgcaacaaaccaaaccatcccaacttgct
gaagcttcagaaaataatactgaaaccatcttatgctttggagatagtattacagctggc
tatggattggaggatagcaatgatgctttccctgctgtattacaagaaaaaattgattct
ttgaatttaaaatatatagttgttaattcaggcttaagcggagaaacaacagcgggtggt
aaaagccgaattgactgggtcttgaatcaagatatcgatatttttctattggagcttgga
gcaaatgatggcttacggggagttcctttatctgaaacgcggtctaaccttcaagcgatt
ataagaactgtaaaagaaaaaagtccgaagacaaaggttattcttgctggtatgcaactg
ccaccgaacatggggcaaaagtacactaccgaattcagagagctgttttctgaattagcc
gaagccaataatctcgcctttattccttttatcttaaaagatgttggcggtatcgccgaa
ctcaatcaaagtgatggcatccacccaacagttgatggtcataaaatagtagcccataca
gtctgggaagtcttaaaaccgatgttggaataa

DBGET integrated database retrieval system