KEGG   Psychroflexus torquis: P700755_003865Help
Entry
P700755_003865    CDS       T02275                                 

Definition
(GenBank) histidinol dehydrogenase HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00340  Histidine metabolism
ptq01100  Metabolic pathways
ptq01110  Biosynthesis of secondary metabolites
ptq01230  Biosynthesis of amino acids
Module
ptq_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    P700755_003865
Enzymes [BR:ptq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     P700755_003865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFU70439
UniProt: K4IJB4
Position
complement(4114433..4115722)
Genome map
AA seq 429 aa AA seqDB search
MKTIQFPKREDWSELLKRPTRTFKDIETTVDDIFKNIQQTGDEAVLKYTSMFDGADLKDL
RVTTTEIENAQHQVSDPLKSAIQLAKSNISKFHEAQKTEPVRVETQPGVTCWQAKKPIQK
VGLYIPGGTASLFSTVLMLAVPAKIAGCSEIVLCTPPNKEGKINPVTLYTAELCGINKIF
KVGGIQAIGAMTFGTESIPKVYKIFGPGNQYVTVAKQVSTTFDVSIDMPAGPSELLIVAD
ETANPEFVASDLLSQAEHGVDSQVVLVSTDEDTITAVQRAIKEQLEVLPRKEMASKAIEN
SKFILVKDQDSALELIDFYGPEHFIISTKDDDFYVDNINNAGSVFIGKYTPESAGDYASG
TNHTLPTNGYAKQYSGVNLDSFNKAITYQKITEEGIKGIGEAVELMAEAEGLQAHKNAMT
LRRKAVENN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatccaatttccaaagagagaagactggtccgaactcttaaaacgacctacg
cgtacttttaaagatatcgaaaccacagtagatgacatctttaagaatattcaacagact
ggggacgaagctgtattaaagtatactagcatgttcgatggagcagatttaaaagatctc
agggtgacgaccacagaaattgaaaatgctcaacaccaagtttcagatccgttaaaatct
gctatccaattagctaaatctaatatttctaagtttcacgaagctcaaaaaacagaacct
gttagggtagaaacacaacctggggtgacctgttggcaagctaaaaaacccatacaaaaa
gtgggcttatatataccaggtggaacagcttctctattttctactgttttgatgttggcc
gtgcccgcgaagatcgctggatgtagtgagattgtattgtgcacgccaccaaacaaggaa
ggtaaaataaatcctgttactttatatactgctgaactttgtggaatcaataaaattttt
aaggtaggaggaatccaagctattggagccatgacttttggaacagaaagcattccaaaa
gtttataagatcttcgggccagggaaccaatatgtaactgtcgccaaacaagtgtccacc
actttcgatgtgtctattgatatgccagcaggcccttcagaactactaattgttgcagat
gaaacggcaaatcctgaatttgtagcttcagacttgttaagtcaggcagagcatggcgtt
gactctcaagtggttttagtgtctacagatgaagacacgattactgccgtgcaaagagca
atcaaagagcaattagaagttttaccaagaaaggaaatggcctctaaagctattgaaaat
tcaaaattcatactggtaaaagaccaagattcagctctagaattaatcgacttctatggt
ccagaacactttattatctctaccaaagacgatgatttttatgttgacaatatcaataat
gcaggttccgttttcataggaaaatacactccagaaagtgcaggagattatgcttctgga
accaaccatactttacctaccaatgggtacgctaagcagtacagtggtgtaaatctagat
agtttcaacaaagcgattacctatcaaaaaattacagaggaaggaattaaaggaattggt
gaagcagtagaacttatggcagaggccgaaggccttcaagctcataaaaatgcgatgact
ttaagacgaaaagcggttgaaaataattaa

DBGET integrated database retrieval system