KEGG   Psychroflexus torquis: P700755_003865Help
Entry
P700755_003865    CDS       T02275                                 

Definition
histidinol dehydrogenase HisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ptq  Psychroflexus torquis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P700755_003865
  Amino acid metabolism
   00340 Histidine metabolism
    P700755_003865
Enzymes [BR:ptq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     P700755_003865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4114433..4115722)
Genome map
AA seq 429 aa AA seqDB search
MKTIQFPKREDWSELLKRPTRTFKDIETTVDDIFKNIQQTGDEAVLKYTSMFDGADLKDL
RVTTTEIENAQHQVSDPLKSAIQLAKSNISKFHEAQKTEPVRVETQPGVTCWQAKKPIQK
VGLYIPGGTASLFSTVLMLAVPAKIAGCSEIVLCTPPNKEGKINPVTLYTAELCGINKIF
KVGGIQAIGAMTFGTESIPKVYKIFGPGNQYVTVAKQVSTTFDVSIDMPAGPSELLIVAD
ETANPEFVASDLLSQAEHGVDSQVVLVSTDEDTITAVQRAIKEQLEVLPRKEMASKAIEN
SKFILVKDQDSALELIDFYGPEHFIISTKDDDFYVDNINNAGSVFIGKYTPESAGDYASG
TNHTLPTNGYAKQYSGVNLDSFNKAITYQKITEEGIKGIGEAVELMAEAEGLQAHKNAMT
LRRKAVENN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatccaatttccaaagagagaagactggtccgaactcttaaaacgacctacg
cgtacttttaaagatatcgaaaccacagtagatgacatctttaagaatattcaacagact
ggggacgaagctgtattaaagtatactagcatgttcgatggagcagatttaaaagatctc
agggtgacgaccacagaaattgaaaatgctcaacaccaagtttcagatccgttaaaatct
gctatccaattagctaaatctaatatttctaagtttcacgaagctcaaaaaacagaacct
gttagggtagaaacacaacctggggtgacctgttggcaagctaaaaaacccatacaaaaa
gtgggcttatatataccaggtggaacagcttctctattttctactgttttgatgttggcc
gtgcccgcgaagatcgctggatgtagtgagattgtattgtgcacgccaccaaacaaggaa
ggtaaaataaatcctgttactttatatactgctgaactttgtggaatcaataaaattttt
aaggtaggaggaatccaagctattggagccatgacttttggaacagaaagcattccaaaa
gtttataagatcttcgggccagggaaccaatatgtaactgtcgccaaacaagtgtccacc
actttcgatgtgtctattgatatgccagcaggcccttcagaactactaattgttgcagat
gaaacggcaaatcctgaatttgtagcttcagacttgttaagtcaggcagagcatggcgtt
gactctcaagtggttttagtgtctacagatgaagacacgattactgccgtgcaaagagca
atcaaagagcaattagaagttttaccaagaaaggaaatggcctctaaagctattgaaaat
tcaaaattcatactggtaaaagaccaagattcagctctagaattaatcgacttctatggt
ccagaacactttattatctctaccaaagacgatgatttttatgttgacaatatcaataat
gcaggttccgttttcataggaaaatacactccagaaagtgcaggagattatgcttctgga
accaaccatactttacctaccaatgggtacgctaagcagtacagtggtgtaaatctagat
agtttcaacaaagcgattacctatcaaaaaattacagaggaaggaattaaaggaattggt
gaagcagtagaacttatggcagaggccgaaggccttcaagctcataaaaatgcgatgact
ttaagacgaaaagcggttgaaaataattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system