KEGG   Psychroflexus torquis: P700755_003904Help
Entry
P700755_003904    CDS       T02275                                 

Definition
(GenBank) GTP cyclohydrolase type 1 FolE
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ptq  Psychroflexus torquis
Pathway
ptq00790  Folate biosynthesis
ptq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    P700755_003904
Enzymes [BR:ptq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     P700755_003904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFU70477
UniProt: K4IIW6
Position
complement(4157716..4158300)
Genome map
AA seq 194 aa AA seqDB search
MPYKTDEEHSQPYVDEIKSSYESILKNIGEDTTRNGIVKTPERAAKAMRFLTQGYNMNPE
EILLGAMFEEPYEDMVLIKDIELYSLCEHHMLPFFGKVHVGYIPNGKIVGLSKIPRIVDV
FARRLQVQERLTHDILECINDTLQPKGVGVVIEAQHMCMMMRGVQKQNSATTTSGFRGEF
KNQETRSEFLKLIG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgccctataaaactgatgaagaacattctcaaccttacgttgatgaaatcaaatccagt
tatgagtctattttaaaaaatatcggcgaggatacaactagaaatggtattgtaaaaaca
ccagaaagagctgctaaagctatgcgatttttgacacaggggtataacatgaatccagaa
gaaattcttcttggggctatgtttgaagaaccttatgaggatatggttttaataaaagat
atcgaattgtattccttgtgtgaacaccatatgttgcctttttttggtaaagttcatgta
ggatatattcctaatggaaaaattgtaggcttaagtaaaattcctagaattgtagatgtg
ttcgccagacggttacaagttcaggaacgtttaactcatgatattttagagtgcataaac
gacaccttacaacccaaaggagtaggtgtggttattgaggctcagcacatgtgtatgatg
atgcgaggagtgcaaaaacagaattcagcaacaactacatcaggattcagaggggaattt
aaaaatcaagaaacacgaagtgagtttttgaaacttataggataa

DBGET integrated database retrieval system