KEGG   Psychroflexus torquis: P700755_003904Help
Entry
P700755_003904    CDS       T02275                                 

Definition
GTP cyclohydrolase type 1 FolE
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ptq  Psychroflexus torquis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    P700755_003904
Enzymes [BR:ptq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     P700755_003904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4157716..4158300)
Genome map
AA seq 194 aa AA seqDB search
MPYKTDEEHSQPYVDEIKSSYESILKNIGEDTTRNGIVKTPERAAKAMRFLTQGYNMNPE
EILLGAMFEEPYEDMVLIKDIELYSLCEHHMLPFFGKVHVGYIPNGKIVGLSKIPRIVDV
FARRLQVQERLTHDILECINDTLQPKGVGVVIEAQHMCMMMRGVQKQNSATTTSGFRGEF
KNQETRSEFLKLIG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgccctataaaactgatgaagaacattctcaaccttacgttgatgaaatcaaatccagt
tatgagtctattttaaaaaatatcggcgaggatacaactagaaatggtattgtaaaaaca
ccagaaagagctgctaaagctatgcgatttttgacacaggggtataacatgaatccagaa
gaaattcttcttggggctatgtttgaagaaccttatgaggatatggttttaataaaagat
atcgaattgtattccttgtgtgaacaccatatgttgcctttttttggtaaagttcatgta
ggatatattcctaatggaaaaattgtaggcttaagtaaaattcctagaattgtagatgtg
ttcgccagacggttacaagttcaggaacgtttaactcatgatattttagagtgcataaac
gacaccttacaacccaaaggagtaggtgtggttattgaggctcagcacatgtgtatgatg
atgcgaggagtgcaaaaacagaattcagcaacaactacatcaggattcagaggggaattt
aaaaatcaagaaacacgaagtgagtttttgaaacttataggataa

DBGET integrated database retrieval system