KEGG   Pan troglodytes (chimpanzee): 100608616Help
Entry
100608616         CDS       T01005                                 

Definition
cytochrome P450 3A7-like
Orthology
K17691  
cytochrome P450, family 3, subfamily A, polypeptide 7 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Retinol metabolism
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100608616
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100608616
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100608616
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100608616
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP3 family
   100608616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 503 aa AA seqDB search
MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTF
DMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITV
FPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSEDSETHKALSDLELMAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFG
GLLLTEKPIVLKAESRDETVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccaaacttggccgtggaaacctggcttctcctggctgtcagcctgata
ctcctctatctatatggaacccgtacacatgggctttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatgctttgtccttccgtaagggctattggacgttt
gacatggaatgttataaaaagtatagaaaagtctggggtatttatgactgtcaacagcct
atgctggctatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaacattcaccagtgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaacacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttaatccattagatccatttgtt
ctctcaataaaagtctttccattccttaccccaattcttgaagcattaaatatcactgtg
tttccaagaaaagttataagttttctaacaaaatctgtaaaacagataaaagaaggtcgc
ctcaaagagacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcagaagactctgagacccacaaagctctgtccgatctggagctcatggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaagtgcagaaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagttggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgagatcaatgggatgtttattcccaaaggggtggtggtgatgattccaagctatgtt
cttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aaaaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcgtgaacatgaaacttgctctagtcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgctttgga
ggacttcttctaacagaaaaacccattgttctaaaggctgagtcaagggatgagaccgta
agtggagcctga

DBGET integrated database retrieval system