KEGG   Pan troglodytes (chimpanzee): 100609296Help
Entry
100609296         CDS       T01005                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase isoform X8
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00564  Glycerophospholipid metabolism
ptr04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100609296 (ACHE)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100609296 (ACHE)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100609296 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ptr00537]
 Enzymes
  100609296 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase AChE_tetra Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 100609296
NCBI-ProteinID: XP_003318708
Ensembl: ENSPTRG00000019514
UniProt: A0A2J8Q8T1
Position
7
AA seq 614 aa AA seqDB search
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccccgcagtgtctgctgcacacgccttccctggcttccccactccttctcctc
ctcctctggctcctgggtggaggagtgggggctgagggccgggaggatgcagagctgctg
gtgacggtgcgtgggggccggctgcggggcattcgcctgaagacccccgggggccctgtc
tctgctttcctgggcatcccctttgcggagccacccatgggaccccgtcgctttctgcca
ccggagcccaagcagccttggtcaggggtggtagacgctacaaccttccagagtgtctgc
taccaatatgtggacaccctatacccaggttttgagggcaccgagatgtggaaccccaac
cgtgagctgagcgaggactgcctgtacctcaacgtgtggacaccatacccccggcctaca
tcccccacccctgtcctcgtctggatctatgggggtggcttctacagtggggcctcctcc
ttggacgtgtacgatggccgcttcttggtacaggccgagaggactgtgctggtgtccatg
aactaccgggtgggagcctttggcttcctggccctgccggggagccgagaggccccgggc
aatgtgggtctcctggatcagaggctggccctgcagtgggtgcaggagaacgtggcagcc
ttcgggggtgacccgacatcagtgacgctgtttggggagagcgcgggagccgcctcggtg
ggcatgcacctgctgtccccgcccagccggggcctgttccacagggccgtgctgcagagc
ggtgcccccaatggaccctgggccacggtgggcatgggagaggcccgtcgcagggccacg
cagctggcccaccttgtgggctgtcctccaggcggcactggtgggaatgacacagagctg
gtagcctgccttcggacacgaccagcgcaggtcctggtgaaccacgaatggcacgtgctg
cctcaagaaagcgtcttccggttctccttcgtgcctgtggtagatggagacttcctcagt
gacaccccagaggccctcatcaacgcaggagacttccacggcctgcaggtgctggtgggt
gtggtgaaggatgagggctcgtattttctggtttacggggccccaggcttcagcaaagac
aacgagtctctcatcagccgggccgagttcctggccggggtgcgggtcggggtcccccag
gtaagtgacctggcagccgaggctgtggtcctgcattacacagactggctgcatcccgag
gacccggcacgcctgagggaggccctgagcgatgtggtgggcgaccacaatgtcgtgtgc
cccgtggcccagctggctgggcgactggctgcccagggtgcccgggtctacgcctacgtc
tttgaacaccgtgcttccacgctctcctggcccctgtggatgggggtgccccacggctac
gagatcgagttcatctttgggatccccctggacccctctcgaaactacacggcagaggag
aaaatcttcgcccagcgactgatgcgatactgggccaactttgcccgcacaggggatccc
aatgagccccgagaccccaaggccccacaatggcccccgtacacggcgggggctcagcag
tacgtgagtctggacctgcggccgctggaggtgcggcgggggctgcgcgcccaggcctgc
gccttctggaaccgcttcctccccaaattgctcagcgccaccgacactctcgacgaggcg
gagcgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagttcgaccactacagcaagcaggatcgctgctcagacctgtga

DBGET integrated database retrieval system